Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6WF84

Protein Details
Accession A0A0L6WF84   
Localization Confidence High
Confidence Score 25
NoLS Segment(s)
PositionSequenceProtein Nature
36-59KDAPAKRGRGRPKGSKNKRPGSTPBasic
64-108GTAVTPRKRGRPPKEKKPDDEADTEPPTKRKRGRPPKNLKPESGDBasic
115-134EATDPSAKKKRGRPSKKATDBasic
NLS Segment(s)
PositionSequence
39-105PAKRGRGRPKGSKNKRPGSTPAASAGTAVTPRKRGRPPKEKKPDDEADTEPPTKRKRGRPPKNLKPE
119-132PSAKKKRGRPSKKA
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSSSPHDPQDEGDDKQNLDELDEPTGGDTEGDVGMKDAPAKRGRGRPKGSKNKRPGSTPAASAGTAVTPRKRGRPPKEKKPDDEADTEPPTKRKRGRPPKNLKPESGDGAEASGEATDPSAKKKRGRPSKKATD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.33
4 0.24
5 0.21
6 0.22
7 0.17
8 0.17
9 0.17
10 0.16
11 0.14
12 0.15
13 0.13
14 0.09
15 0.07
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.06
22 0.07
23 0.1
24 0.1
25 0.15
26 0.19
27 0.23
28 0.28
29 0.37
30 0.46
31 0.53
32 0.59
33 0.64
34 0.71
35 0.79
36 0.83
37 0.85
38 0.86
39 0.85
40 0.81
41 0.74
42 0.69
43 0.65
44 0.57
45 0.48
46 0.41
47 0.33
48 0.29
49 0.25
50 0.19
51 0.12
52 0.12
53 0.12
54 0.1
55 0.14
56 0.16
57 0.22
58 0.3
59 0.4
60 0.48
61 0.58
62 0.67
63 0.72
64 0.82
65 0.82
66 0.79
67 0.77
68 0.73
69 0.66
70 0.61
71 0.53
72 0.48
73 0.45
74 0.42
75 0.36
76 0.36
77 0.35
78 0.38
79 0.43
80 0.47
81 0.54
82 0.64
83 0.73
84 0.79
85 0.86
86 0.9
87 0.93
88 0.89
89 0.81
90 0.76
91 0.69
92 0.63
93 0.53
94 0.43
95 0.32
96 0.28
97 0.24
98 0.17
99 0.13
100 0.07
101 0.06
102 0.05
103 0.05
104 0.08
105 0.09
106 0.17
107 0.26
108 0.32
109 0.39
110 0.48
111 0.58
112 0.66
113 0.76
114 0.79