Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6WTD4

Protein Details
Accession A0A0L6WTD4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
98-118VPPQSNPKPRNTRRRQPISIPHydrophilic
171-213LVTPTRPKQHRPHPSPPQQPQPIHHSKRRPRHHKRVPSDSGIVHydrophilic
NLS Segment(s)
PositionSequence
192-205PIHHSKRRPRHHKR
Subcellular Location(s) nucl 15, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MMLVQKPPSFNLNASPVRHRRHPSSPPVVLVQPTQIPGLLTLSKPQQQQQPRSSLRAKAAPSTPSPASKSRPAKDKHATPPSRSAPSQAEGPSDPFFVPPQSNPKPRNTRRRQPISIPVPSTQPQTARSVPLPHHRPAKRTVAPEPLLPAFNLRVCDDMSDHEASSDAPALVTPTRPKQHRPHPSPPQQPQPIHHSKRRPRHHKRVPSDSGIVFHMSSDESGPETLPNKINVLFQGIKLPSTPPPAQREFIYEAMAQREVQGYFASSSFQNSPSPEELPDPEFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.48
3 0.52
4 0.55
5 0.63
6 0.63
7 0.62
8 0.66
9 0.72
10 0.72
11 0.73
12 0.71
13 0.65
14 0.62
15 0.57
16 0.49
17 0.41
18 0.34
19 0.26
20 0.24
21 0.21
22 0.18
23 0.16
24 0.14
25 0.17
26 0.16
27 0.14
28 0.16
29 0.21
30 0.25
31 0.28
32 0.32
33 0.37
34 0.44
35 0.53
36 0.56
37 0.62
38 0.61
39 0.66
40 0.65
41 0.62
42 0.58
43 0.55
44 0.5
45 0.46
46 0.46
47 0.42
48 0.4
49 0.4
50 0.37
51 0.35
52 0.37
53 0.36
54 0.37
55 0.42
56 0.49
57 0.49
58 0.56
59 0.56
60 0.61
61 0.65
62 0.69
63 0.69
64 0.71
65 0.7
66 0.65
67 0.7
68 0.66
69 0.63
70 0.54
71 0.49
72 0.41
73 0.38
74 0.39
75 0.31
76 0.28
77 0.23
78 0.26
79 0.23
80 0.21
81 0.19
82 0.15
83 0.14
84 0.14
85 0.14
86 0.14
87 0.22
88 0.29
89 0.37
90 0.4
91 0.48
92 0.57
93 0.65
94 0.74
95 0.74
96 0.77
97 0.79
98 0.86
99 0.81
100 0.76
101 0.77
102 0.73
103 0.69
104 0.61
105 0.51
106 0.46
107 0.42
108 0.38
109 0.3
110 0.24
111 0.21
112 0.23
113 0.23
114 0.22
115 0.23
116 0.23
117 0.25
118 0.32
119 0.34
120 0.33
121 0.41
122 0.41
123 0.42
124 0.43
125 0.5
126 0.45
127 0.44
128 0.44
129 0.43
130 0.42
131 0.39
132 0.37
133 0.29
134 0.24
135 0.21
136 0.18
137 0.11
138 0.12
139 0.13
140 0.1
141 0.11
142 0.1
143 0.11
144 0.1
145 0.11
146 0.13
147 0.12
148 0.12
149 0.11
150 0.11
151 0.1
152 0.1
153 0.1
154 0.06
155 0.05
156 0.05
157 0.06
158 0.07
159 0.09
160 0.11
161 0.16
162 0.23
163 0.25
164 0.33
165 0.4
166 0.5
167 0.59
168 0.65
169 0.7
170 0.74
171 0.82
172 0.85
173 0.83
174 0.82
175 0.79
176 0.73
177 0.66
178 0.65
179 0.65
180 0.62
181 0.63
182 0.63
183 0.65
184 0.73
185 0.8
186 0.82
187 0.82
188 0.87
189 0.91
190 0.91
191 0.91
192 0.91
193 0.86
194 0.8
195 0.74
196 0.64
197 0.54
198 0.45
199 0.37
200 0.26
201 0.2
202 0.15
203 0.1
204 0.1
205 0.09
206 0.08
207 0.08
208 0.08
209 0.08
210 0.11
211 0.12
212 0.15
213 0.17
214 0.18
215 0.19
216 0.2
217 0.21
218 0.19
219 0.25
220 0.22
221 0.2
222 0.26
223 0.25
224 0.24
225 0.23
226 0.24
227 0.22
228 0.28
229 0.32
230 0.31
231 0.38
232 0.41
233 0.43
234 0.42
235 0.44
236 0.41
237 0.39
238 0.36
239 0.3
240 0.28
241 0.29
242 0.29
243 0.23
244 0.19
245 0.21
246 0.17
247 0.17
248 0.15
249 0.14
250 0.14
251 0.14
252 0.15
253 0.12
254 0.16
255 0.18
256 0.19
257 0.21
258 0.21
259 0.26
260 0.28
261 0.29
262 0.27
263 0.28
264 0.3