Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6W703

Protein Details
Accession A0A0L6W703    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-31SHTLCRRCGNRAFHKQHKTCHydrophilic
NLS Segment(s)
PositionSequence
49-55KAKRRKT
Subcellular Location(s) mito 12, cyto 9.5, cyto_nucl 8, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences GTSSFGKRHTKSHTLCRRCGNRAFHKQHKTCAQCGYPSAKLRSYEWGQKAKRRKTTGTGRMRYLKDVSRRFKNGFRENTVAKKRVKTTTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.72
3 0.75
4 0.74
5 0.71
6 0.73
7 0.72
8 0.71
9 0.75
10 0.78
11 0.78
12 0.8
13 0.77
14 0.77
15 0.76
16 0.7
17 0.63
18 0.6
19 0.52
20 0.43
21 0.43
22 0.4
23 0.37
24 0.36
25 0.36
26 0.32
27 0.32
28 0.31
29 0.34
30 0.32
31 0.33
32 0.34
33 0.4
34 0.4
35 0.45
36 0.54
37 0.56
38 0.62
39 0.6
40 0.58
41 0.58
42 0.66
43 0.7
44 0.71
45 0.67
46 0.64
47 0.66
48 0.64
49 0.59
50 0.52
51 0.48
52 0.47
53 0.52
54 0.54
55 0.55
56 0.6
57 0.6
58 0.63
59 0.67
60 0.67
61 0.66
62 0.65
63 0.62
64 0.61
65 0.67
66 0.69
67 0.65
68 0.61
69 0.61
70 0.6
71 0.63