Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6W7P4

Protein Details
Accession A0A0L6W7P4    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-48MAVKIPIVKKRTNKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQTHydrophilic
NLS Segment(s)
PositionSequence
9-45KKRTNKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFK
Subcellular Location(s) mito 17, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002737  MEMO1_fam  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01875  Memo  
PF01655  Ribosomal_L32e  
CDD cd07361  MEMO_like  
cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAVKIPIVKKRTNKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQTAMPKIGYGSNAKTRHLLPNGLKKFVVNNVREVDLLLMHNKSFAAEIAHNVSSRNRTVILERAKALGIKVTNPAARLRSEDTSDVRRASHAGDWYTANGKSSSPSISKSALISLPPGSELDSQLTAWLACVTPSDDAYPIKGCKAVIAPHAGYAYSGPAAAWAYKSIDTTGIKRVFILGPSHHFYLEGCALSSCEEYDTPIGKLRLDLEIIEELRGTGRFEMMDIKADEAEHSIEMHLPYVRKVFAGQDIKIVPIVVGAISKSAEASFGSILAPYLERKDTFCIVSSDFCHWGTRFSYTYYYPKAPPSDVAAIKLSRSVDPTPANPIHESIRQLDHEGMDRLILTPCSAAAAHTAFAEYLAKTRNTICGRHPIGVLLGALASLEVSRGVQPMLRWVRYEQSSACLTIVDSSVSYASAWVRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.88
3 0.91
4 0.92
5 0.92
6 0.91
7 0.9
8 0.89
9 0.87
10 0.79
11 0.71
12 0.66
13 0.64
14 0.64
15 0.64
16 0.64
17 0.6
18 0.57
19 0.58
20 0.62
21 0.65
22 0.66
23 0.66
24 0.67
25 0.74
26 0.83
27 0.88
28 0.82
29 0.81
30 0.79
31 0.77
32 0.76
33 0.74
34 0.75
35 0.75
36 0.78
37 0.69
38 0.61
39 0.54
40 0.45
41 0.39
42 0.33
43 0.3
44 0.33
45 0.34
46 0.35
47 0.37
48 0.38
49 0.43
50 0.43
51 0.45
52 0.44
53 0.52
54 0.55
55 0.55
56 0.52
57 0.44
58 0.43
59 0.43
60 0.44
61 0.35
62 0.37
63 0.36
64 0.37
65 0.36
66 0.33
67 0.26
68 0.19
69 0.19
70 0.16
71 0.14
72 0.13
73 0.14
74 0.13
75 0.12
76 0.11
77 0.1
78 0.11
79 0.11
80 0.14
81 0.18
82 0.19
83 0.19
84 0.2
85 0.22
86 0.22
87 0.23
88 0.22
89 0.19
90 0.19
91 0.22
92 0.3
93 0.33
94 0.33
95 0.33
96 0.32
97 0.31
98 0.3
99 0.28
100 0.24
101 0.18
102 0.16
103 0.18
104 0.21
105 0.21
106 0.22
107 0.25
108 0.23
109 0.23
110 0.25
111 0.25
112 0.24
113 0.25
114 0.27
115 0.28
116 0.32
117 0.33
118 0.31
119 0.27
120 0.25
121 0.23
122 0.22
123 0.22
124 0.2
125 0.19
126 0.19
127 0.2
128 0.2
129 0.22
130 0.2
131 0.18
132 0.15
133 0.14
134 0.13
135 0.14
136 0.16
137 0.15
138 0.17
139 0.18
140 0.19
141 0.2
142 0.19
143 0.2
144 0.18
145 0.16
146 0.16
147 0.14
148 0.12
149 0.12
150 0.11
151 0.11
152 0.11
153 0.12
154 0.12
155 0.11
156 0.11
157 0.11
158 0.11
159 0.08
160 0.07
161 0.07
162 0.05
163 0.05
164 0.05
165 0.06
166 0.07
167 0.07
168 0.08
169 0.09
170 0.09
171 0.11
172 0.13
173 0.12
174 0.12
175 0.13
176 0.12
177 0.12
178 0.14
179 0.15
180 0.15
181 0.19
182 0.18
183 0.18
184 0.18
185 0.17
186 0.14
187 0.12
188 0.1
189 0.06
190 0.06
191 0.04
192 0.05
193 0.05
194 0.06
195 0.06
196 0.06
197 0.07
198 0.08
199 0.08
200 0.08
201 0.11
202 0.12
203 0.14
204 0.21
205 0.21
206 0.21
207 0.2
208 0.22
209 0.18
210 0.19
211 0.19
212 0.13
213 0.15
214 0.18
215 0.19
216 0.17
217 0.16
218 0.15
219 0.15
220 0.15
221 0.11
222 0.09
223 0.08
224 0.08
225 0.09
226 0.09
227 0.06
228 0.06
229 0.05
230 0.06
231 0.08
232 0.09
233 0.09
234 0.13
235 0.13
236 0.12
237 0.13
238 0.13
239 0.12
240 0.11
241 0.11
242 0.09
243 0.11
244 0.11
245 0.11
246 0.09
247 0.08
248 0.08
249 0.09
250 0.08
251 0.05
252 0.06
253 0.05
254 0.06
255 0.09
256 0.09
257 0.12
258 0.12
259 0.12
260 0.12
261 0.12
262 0.12
263 0.1
264 0.1
265 0.07
266 0.07
267 0.06
268 0.08
269 0.08
270 0.08
271 0.09
272 0.09
273 0.1
274 0.12
275 0.12
276 0.1
277 0.11
278 0.12
279 0.18
280 0.22
281 0.21
282 0.23
283 0.24
284 0.24
285 0.23
286 0.22
287 0.13
288 0.09
289 0.09
290 0.05
291 0.05
292 0.04
293 0.05
294 0.05
295 0.05
296 0.05
297 0.05
298 0.05
299 0.05
300 0.06
301 0.06
302 0.06
303 0.06
304 0.06
305 0.06
306 0.06
307 0.07
308 0.06
309 0.09
310 0.11
311 0.11
312 0.13
313 0.17
314 0.18
315 0.19
316 0.2
317 0.19
318 0.19
319 0.21
320 0.21
321 0.21
322 0.21
323 0.21
324 0.22
325 0.2
326 0.21
327 0.2
328 0.22
329 0.2
330 0.2
331 0.23
332 0.24
333 0.3
334 0.32
335 0.34
336 0.32
337 0.36
338 0.37
339 0.35
340 0.33
341 0.32
342 0.35
343 0.32
344 0.32
345 0.31
346 0.28
347 0.27
348 0.28
349 0.24
350 0.18
351 0.21
352 0.2
353 0.22
354 0.25
355 0.26
356 0.31
357 0.32
358 0.33
359 0.3
360 0.31
361 0.29
362 0.29
363 0.31
364 0.26
365 0.28
366 0.27
367 0.28
368 0.28
369 0.25
370 0.25
371 0.24
372 0.21
373 0.17
374 0.16
375 0.15
376 0.15
377 0.13
378 0.1
379 0.09
380 0.09
381 0.1
382 0.09
383 0.09
384 0.1
385 0.11
386 0.11
387 0.11
388 0.12
389 0.1
390 0.11
391 0.12
392 0.09
393 0.11
394 0.15
395 0.15
396 0.17
397 0.18
398 0.27
399 0.29
400 0.32
401 0.33
402 0.4
403 0.43
404 0.44
405 0.43
406 0.35
407 0.33
408 0.31
409 0.26
410 0.16
411 0.12
412 0.09
413 0.08
414 0.06
415 0.05
416 0.03
417 0.04
418 0.04
419 0.05
420 0.06
421 0.08
422 0.08
423 0.1
424 0.11
425 0.21
426 0.29
427 0.3
428 0.31
429 0.33
430 0.41
431 0.42
432 0.46
433 0.37
434 0.34
435 0.34
436 0.33
437 0.3
438 0.23
439 0.2
440 0.18
441 0.17
442 0.14
443 0.11
444 0.11
445 0.11
446 0.11
447 0.11
448 0.11