Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6WIX6

Protein Details
Accession A0A0L6WIX6   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-33SFYTDFIPVNRKKRKNKSRPAKEPLLAHydrophilic
NLS Segment(s)
PositionSequence
17-28RKKRKNKSRPAK
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MTTPSTSFYTDFIPVNRKKRKNKSRPAKEPLLAIIQRLRDELLSAQDNDWLPQCQQIITESFVDRPAPEQIICLGLGSPAASPNARAQLAFLIVISQYLHIVST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.44
3 0.52
4 0.59
5 0.67
6 0.76
7 0.85
8 0.87
9 0.91
10 0.92
11 0.93
12 0.94
13 0.92
14 0.89
15 0.8
16 0.7
17 0.62
18 0.58
19 0.47
20 0.37
21 0.32
22 0.25
23 0.24
24 0.22
25 0.2
26 0.12
27 0.13
28 0.12
29 0.12
30 0.12
31 0.13
32 0.12
33 0.15
34 0.15
35 0.14
36 0.15
37 0.12
38 0.1
39 0.11
40 0.11
41 0.08
42 0.09
43 0.1
44 0.1
45 0.11
46 0.12
47 0.11
48 0.11
49 0.12
50 0.12
51 0.11
52 0.11
53 0.11
54 0.12
55 0.11
56 0.11
57 0.11
58 0.12
59 0.12
60 0.1
61 0.08
62 0.06
63 0.07
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.09
70 0.12
71 0.17
72 0.17
73 0.17
74 0.17
75 0.17
76 0.18
77 0.17
78 0.13
79 0.09
80 0.09
81 0.1
82 0.09
83 0.08
84 0.07