Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6WUY3

Protein Details
Accession A0A0L6WUY3    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
64-83NTLAARRSRKRKLENVHRLEHydrophilic
NLS Segment(s)
PositionSequence
68-75ARRSRKRK
Subcellular Location(s) nucl 23, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd12193  bZIP_GCN4  
Amino Acid Sequences MDAPTQPRNYVTPSATSRKEVPAFFYKMRNPSPPSEEELDELTEEPPASNATDQEKIEYKRRQNTLAARRSRKRKLENVHRLEETVERLTREREIWKTRALTLKQLLISHGIICPEFRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.44
4 0.42
5 0.44
6 0.46
7 0.4
8 0.4
9 0.4
10 0.43
11 0.42
12 0.46
13 0.43
14 0.46
15 0.49
16 0.5
17 0.46
18 0.45
19 0.48
20 0.44
21 0.44
22 0.4
23 0.37
24 0.31
25 0.28
26 0.24
27 0.19
28 0.17
29 0.12
30 0.1
31 0.09
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.08
38 0.1
39 0.14
40 0.14
41 0.15
42 0.2
43 0.21
44 0.29
45 0.34
46 0.36
47 0.4
48 0.42
49 0.43
50 0.44
51 0.51
52 0.53
53 0.55
54 0.59
55 0.6
56 0.65
57 0.71
58 0.74
59 0.74
60 0.72
61 0.72
62 0.75
63 0.78
64 0.81
65 0.79
66 0.76
67 0.67
68 0.6
69 0.52
70 0.43
71 0.36
72 0.29
73 0.24
74 0.2
75 0.21
76 0.22
77 0.23
78 0.24
79 0.26
80 0.3
81 0.35
82 0.37
83 0.41
84 0.42
85 0.44
86 0.51
87 0.47
88 0.47
89 0.44
90 0.46
91 0.43
92 0.41
93 0.38
94 0.32
95 0.31
96 0.24
97 0.22
98 0.18
99 0.16