Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6W9U4

Protein Details
Accession A0A0L6W9U4    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-43NRHPPPPSSSAKPRRHSRRTPKSSGSQYIHydrophilic
NLS Segment(s)
PositionSequence
24-35SAKPRRHSRRTP
Subcellular Location(s) nucl 9, cyto_nucl 8, mito 7, cyto 5, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIPSTYQRGTILDHNRHPPPPSSSAKPRRHSRRTPKSSGSQYISHRVALRTLVLILLNVTYVSRSYLSLLVLSHLHFVIVLVIVSYLYFESTLVLYQPRPISSDAVSVTLSDHCAQVFIDLNNLMNSAITITDPDTPLSGPNLTLRSVPDSISSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.54
3 0.56
4 0.55
5 0.51
6 0.48
7 0.48
8 0.48
9 0.49
10 0.56
11 0.63
12 0.7
13 0.74
14 0.79
15 0.82
16 0.85
17 0.88
18 0.88
19 0.89
20 0.89
21 0.88
22 0.85
23 0.83
24 0.81
25 0.77
26 0.7
27 0.64
28 0.59
29 0.58
30 0.52
31 0.45
32 0.4
33 0.33
34 0.3
35 0.25
36 0.21
37 0.14
38 0.13
39 0.11
40 0.08
41 0.08
42 0.07
43 0.06
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.06
52 0.07
53 0.08
54 0.08
55 0.09
56 0.09
57 0.09
58 0.09
59 0.09
60 0.08
61 0.07
62 0.07
63 0.06
64 0.05
65 0.05
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.04
79 0.04
80 0.05
81 0.06
82 0.06
83 0.1
84 0.11
85 0.11
86 0.13
87 0.14
88 0.15
89 0.15
90 0.19
91 0.16
92 0.16
93 0.16
94 0.14
95 0.13
96 0.12
97 0.13
98 0.1
99 0.1
100 0.08
101 0.09
102 0.08
103 0.09
104 0.11
105 0.1
106 0.11
107 0.11
108 0.13
109 0.12
110 0.13
111 0.11
112 0.08
113 0.08
114 0.06
115 0.06
116 0.05
117 0.06
118 0.07
119 0.1
120 0.11
121 0.12
122 0.12
123 0.12
124 0.13
125 0.15
126 0.14
127 0.13
128 0.16
129 0.18
130 0.18
131 0.19
132 0.2
133 0.23
134 0.23
135 0.23