Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6WJ46

Protein Details
Accession A0A0L6WJ46    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-22RGTGKFKQKRGGGRNFSKNMHydrophilic
NLS Segment(s)
PositionSequence
135-149RREREEKEKKEAKER
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019380  Casein_kinase_sb_PP28  
IPR039876  HAP28  
Pfam View protein in Pfam  
PF10252  PP28  
Amino Acid Sequences MVRGTGKFKQKRGGGRNFSKNMTLDEDGHAVGRSTLYDRRDPRNSDDDEEDDLEEESEEEEEGEEGESEEDISAGKEAVEELTRAERRELKKKQAAEKLADKQKAVGEDEDLINPNHVEKKLNISDLGSSRELSRREREEKEKKEAKERYWKLHVQGKTQEAKTDLARLAKIRAEREEAQAKRKAEAEGKSILAFFSTLTHSSVQPRLLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.83
4 0.79
5 0.74
6 0.68
7 0.6
8 0.52
9 0.48
10 0.41
11 0.32
12 0.3
13 0.29
14 0.24
15 0.24
16 0.2
17 0.14
18 0.12
19 0.1
20 0.09
21 0.11
22 0.16
23 0.18
24 0.26
25 0.31
26 0.39
27 0.46
28 0.49
29 0.52
30 0.56
31 0.56
32 0.52
33 0.5
34 0.45
35 0.4
36 0.37
37 0.31
38 0.23
39 0.2
40 0.16
41 0.12
42 0.09
43 0.07
44 0.05
45 0.05
46 0.05
47 0.05
48 0.04
49 0.05
50 0.05
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.06
69 0.12
70 0.14
71 0.15
72 0.17
73 0.22
74 0.27
75 0.37
76 0.42
77 0.45
78 0.5
79 0.55
80 0.61
81 0.62
82 0.61
83 0.56
84 0.57
85 0.56
86 0.57
87 0.53
88 0.44
89 0.38
90 0.36
91 0.33
92 0.27
93 0.18
94 0.12
95 0.12
96 0.13
97 0.12
98 0.11
99 0.1
100 0.09
101 0.08
102 0.08
103 0.1
104 0.1
105 0.11
106 0.11
107 0.18
108 0.2
109 0.21
110 0.21
111 0.18
112 0.21
113 0.21
114 0.24
115 0.17
116 0.16
117 0.16
118 0.2
119 0.22
120 0.23
121 0.28
122 0.31
123 0.37
124 0.43
125 0.52
126 0.57
127 0.61
128 0.68
129 0.69
130 0.65
131 0.69
132 0.68
133 0.65
134 0.66
135 0.65
136 0.63
137 0.63
138 0.63
139 0.59
140 0.6
141 0.57
142 0.52
143 0.53
144 0.52
145 0.52
146 0.49
147 0.46
148 0.4
149 0.4
150 0.34
151 0.33
152 0.29
153 0.24
154 0.26
155 0.25
156 0.25
157 0.26
158 0.29
159 0.28
160 0.29
161 0.33
162 0.33
163 0.39
164 0.45
165 0.45
166 0.48
167 0.51
168 0.48
169 0.44
170 0.44
171 0.42
172 0.39
173 0.4
174 0.37
175 0.34
176 0.35
177 0.33
178 0.3
179 0.26
180 0.2
181 0.15
182 0.12
183 0.1
184 0.12
185 0.12
186 0.14
187 0.16
188 0.17
189 0.23
190 0.27