Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6WG04

Protein Details
Accession A0A0L6WG04    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
159-182KGKVVVHKGPKPKKIKPSDIPDLTBasic
NLS Segment(s)
PositionSequence
129-141KGEAKEWRKREYK
153-174KEGGPAKGKVVVHKGPKPKKIK
Subcellular Location(s) nucl 14.5, cyto_nucl 11.833, mito_nucl 9.666, cyto 7, mito 3.5
Family & Domain DBs
Amino Acid Sequences MEQRASEAIEGLLDVSKEWKEREVRPARGLLAVFLEGTGTAEPAVDTSDTTNSQPEPSSGKKFALFSDTTLTDQEHLIRRMRKELAKGSRVELVLSAKKTGPSTIGLEDDTLSVNELQVRAGKLIKILKGEAKEWRKREYKPMSAKLFVFLEKEGGPAKGKVVVHKGPKPKKIKPSDIPDLTLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.11
4 0.14
5 0.15
6 0.21
7 0.25
8 0.3
9 0.41
10 0.48
11 0.52
12 0.53
13 0.55
14 0.5
15 0.48
16 0.43
17 0.33
18 0.26
19 0.2
20 0.16
21 0.12
22 0.11
23 0.07
24 0.08
25 0.07
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.05
33 0.05
34 0.07
35 0.09
36 0.1
37 0.11
38 0.13
39 0.12
40 0.14
41 0.14
42 0.14
43 0.17
44 0.2
45 0.26
46 0.26
47 0.27
48 0.28
49 0.28
50 0.28
51 0.27
52 0.23
53 0.18
54 0.2
55 0.2
56 0.18
57 0.18
58 0.18
59 0.13
60 0.13
61 0.15
62 0.16
63 0.17
64 0.21
65 0.24
66 0.25
67 0.29
68 0.33
69 0.33
70 0.33
71 0.39
72 0.42
73 0.42
74 0.42
75 0.39
76 0.38
77 0.35
78 0.31
79 0.23
80 0.19
81 0.17
82 0.17
83 0.17
84 0.13
85 0.15
86 0.15
87 0.14
88 0.12
89 0.11
90 0.13
91 0.13
92 0.14
93 0.13
94 0.12
95 0.12
96 0.11
97 0.1
98 0.07
99 0.07
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.08
106 0.09
107 0.09
108 0.1
109 0.1
110 0.14
111 0.17
112 0.19
113 0.18
114 0.19
115 0.22
116 0.23
117 0.25
118 0.31
119 0.37
120 0.43
121 0.44
122 0.51
123 0.53
124 0.54
125 0.62
126 0.62
127 0.63
128 0.65
129 0.71
130 0.69
131 0.67
132 0.64
133 0.57
134 0.5
135 0.41
136 0.32
137 0.24
138 0.2
139 0.17
140 0.18
141 0.16
142 0.16
143 0.17
144 0.16
145 0.16
146 0.2
147 0.2
148 0.24
149 0.3
150 0.36
151 0.42
152 0.49
153 0.59
154 0.62
155 0.71
156 0.75
157 0.76
158 0.79
159 0.81
160 0.84
161 0.83
162 0.83
163 0.85
164 0.79