Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6WDJ0

Protein Details
Accession A0A0L6WDJ0   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
169-191GLAQRRGDRRGHRGRKERDDVMYBasic
NLS Segment(s)
PositionSequence
173-184RRGDRRGHRGRK
Subcellular Location(s) cyto 14, mito 10, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013926  CGI121/TPRKB  
IPR036504  CGI121/TPRKB_sf  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08617  CGI-121  
Amino Acid Sequences METYSFVQFGGPRREVHVALYTNVTNGGEVRRRIVEAGTAGGVKFGYIDARLITSRVHLQTAIYQAMLAEAQDGLRTRTVHSEVIWALNPTNNITEGLRRYGVSAETSAVIVVSMDGAGEGQLGAGIAGTLTPLDALHGLTDWATVCKVRSITVLLLSTDWPAVSQAGGLAQRRGDRRGHRGRKERDDVMYPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.36
4 0.36
5 0.3
6 0.29
7 0.31
8 0.27
9 0.23
10 0.24
11 0.2
12 0.13
13 0.12
14 0.17
15 0.19
16 0.2
17 0.23
18 0.23
19 0.24
20 0.24
21 0.24
22 0.21
23 0.16
24 0.17
25 0.15
26 0.14
27 0.12
28 0.12
29 0.11
30 0.08
31 0.07
32 0.06
33 0.06
34 0.06
35 0.07
36 0.06
37 0.09
38 0.09
39 0.1
40 0.1
41 0.1
42 0.15
43 0.16
44 0.16
45 0.14
46 0.15
47 0.17
48 0.2
49 0.19
50 0.13
51 0.12
52 0.11
53 0.11
54 0.1
55 0.07
56 0.04
57 0.04
58 0.04
59 0.05
60 0.06
61 0.06
62 0.09
63 0.1
64 0.1
65 0.14
66 0.16
67 0.16
68 0.16
69 0.17
70 0.15
71 0.17
72 0.16
73 0.13
74 0.11
75 0.11
76 0.11
77 0.09
78 0.09
79 0.08
80 0.09
81 0.09
82 0.11
83 0.11
84 0.12
85 0.12
86 0.11
87 0.12
88 0.12
89 0.12
90 0.1
91 0.1
92 0.08
93 0.08
94 0.08
95 0.07
96 0.06
97 0.05
98 0.04
99 0.03
100 0.03
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.03
122 0.04
123 0.04
124 0.04
125 0.05
126 0.05
127 0.05
128 0.06
129 0.05
130 0.06
131 0.06
132 0.07
133 0.08
134 0.11
135 0.11
136 0.12
137 0.13
138 0.16
139 0.16
140 0.2
141 0.2
142 0.18
143 0.18
144 0.17
145 0.17
146 0.14
147 0.12
148 0.08
149 0.08
150 0.08
151 0.07
152 0.06
153 0.06
154 0.09
155 0.13
156 0.14
157 0.15
158 0.17
159 0.23
160 0.26
161 0.29
162 0.34
163 0.38
164 0.48
165 0.57
166 0.65
167 0.71
168 0.78
169 0.85
170 0.88
171 0.88
172 0.83
173 0.78