Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6WIT2

Protein Details
Accession A0A0L6WIT2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTIHIKNLKVRPRKNPAHNMCGPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MTIHIKNLKVRPRKNPAHNMCGPQLAAMLGCWAAHQDFNSAGLCKEAAETLFYCMRTTPLPKKLPKPAINYHLARLGKNIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.82
4 0.81
5 0.79
6 0.73
7 0.65
8 0.57
9 0.47
10 0.36
11 0.28
12 0.19
13 0.14
14 0.09
15 0.07
16 0.05
17 0.05
18 0.04
19 0.05
20 0.05
21 0.05
22 0.06
23 0.06
24 0.06
25 0.08
26 0.09
27 0.09
28 0.08
29 0.08
30 0.07
31 0.06
32 0.07
33 0.06
34 0.05
35 0.06
36 0.07
37 0.1
38 0.12
39 0.12
40 0.12
41 0.12
42 0.14
43 0.15
44 0.21
45 0.27
46 0.33
47 0.41
48 0.48
49 0.55
50 0.64
51 0.71
52 0.72
53 0.71
54 0.71
55 0.7
56 0.72
57 0.67
58 0.59
59 0.57
60 0.51
61 0.44