Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6WER1

Protein Details
Accession A0A0L6WER1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MVFMCKKCKKAFRKDMSSYEESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MVFMCKKCKKAFRKDMSSYEESDEYCPHCDNHYVLEAKTPQAVVGVEGEDARVDNRMIKDDRIKTIHTRSIFSEEEFSERLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.81
4 0.74
5 0.64
6 0.57
7 0.48
8 0.38
9 0.33
10 0.27
11 0.21
12 0.2
13 0.19
14 0.16
15 0.16
16 0.17
17 0.16
18 0.16
19 0.19
20 0.18
21 0.17
22 0.21
23 0.2
24 0.18
25 0.18
26 0.16
27 0.11
28 0.1
29 0.1
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.09
42 0.1
43 0.15
44 0.17
45 0.2
46 0.28
47 0.31
48 0.37
49 0.37
50 0.4
51 0.41
52 0.46
53 0.5
54 0.44
55 0.42
56 0.39
57 0.43
58 0.41
59 0.36
60 0.33
61 0.27
62 0.29