Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6BSI8

Protein Details
Accession Q6BSI8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
172-196LRLAKSDKKYKGIREKRTREKAEAEBasic
NLS Segment(s)
PositionSequence
31-45KKASRRDHRLTKAAK
175-202AKSDKKYKGIREKRTREKAEAEADKKKK
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR001380  Ribosomal_L13e  
IPR018256  Ribosomal_L13e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG dha:DEHA2D08536g  -  
Pfam View protein in Pfam  
PF01294  Ribosomal_L13e  
PROSITE View protein in PROSITE  
PS01104  RIBOSOMAL_L13E  
Amino Acid Sequences MAISKNLPLLKNHFRKHWQERVKVHLDQAGKKASRRDHRLTKAAKIAPRPIDTLRPVVRCPTIKYNRKVRAGRGFTLAELKAVGLSAKYARTIGISVDHRRQNRSEETFEANVARLQEYKSKLVVFDKNTKAAEAASHKQADVATVFPVVQPSVESAPRAVEQPEQSAFRTLRLAKSDKKYKGIREKRTREKAEAEADKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.69
3 0.75
4 0.77
5 0.76
6 0.76
7 0.78
8 0.78
9 0.77
10 0.69
11 0.62
12 0.57
13 0.52
14 0.47
15 0.46
16 0.46
17 0.42
18 0.42
19 0.47
20 0.5
21 0.55
22 0.59
23 0.63
24 0.65
25 0.7
26 0.76
27 0.73
28 0.71
29 0.7
30 0.67
31 0.62
32 0.57
33 0.56
34 0.53
35 0.51
36 0.48
37 0.42
38 0.43
39 0.4
40 0.43
41 0.41
42 0.37
43 0.36
44 0.36
45 0.39
46 0.35
47 0.37
48 0.41
49 0.45
50 0.52
51 0.58
52 0.65
53 0.68
54 0.75
55 0.73
56 0.7
57 0.7
58 0.66
59 0.61
60 0.55
61 0.47
62 0.38
63 0.39
64 0.31
65 0.21
66 0.16
67 0.14
68 0.09
69 0.08
70 0.08
71 0.03
72 0.04
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.07
79 0.08
80 0.07
81 0.11
82 0.14
83 0.17
84 0.23
85 0.28
86 0.29
87 0.31
88 0.32
89 0.32
90 0.34
91 0.36
92 0.32
93 0.3
94 0.33
95 0.31
96 0.3
97 0.26
98 0.2
99 0.17
100 0.14
101 0.12
102 0.09
103 0.09
104 0.14
105 0.17
106 0.18
107 0.18
108 0.18
109 0.19
110 0.23
111 0.27
112 0.26
113 0.33
114 0.34
115 0.36
116 0.36
117 0.35
118 0.31
119 0.26
120 0.25
121 0.22
122 0.23
123 0.23
124 0.23
125 0.23
126 0.24
127 0.23
128 0.21
129 0.15
130 0.13
131 0.09
132 0.09
133 0.09
134 0.08
135 0.09
136 0.08
137 0.07
138 0.06
139 0.08
140 0.11
141 0.12
142 0.12
143 0.12
144 0.14
145 0.15
146 0.16
147 0.15
148 0.17
149 0.17
150 0.21
151 0.24
152 0.24
153 0.24
154 0.29
155 0.28
156 0.25
157 0.3
158 0.28
159 0.3
160 0.34
161 0.39
162 0.41
163 0.51
164 0.59
165 0.58
166 0.65
167 0.66
168 0.7
169 0.76
170 0.78
171 0.79
172 0.81
173 0.86
174 0.88
175 0.92
176 0.89
177 0.84
178 0.8
179 0.76
180 0.75
181 0.74
182 0.7