Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6WJ94

Protein Details
Accession A0A0L6WJ94    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-83DKTLTLTDRDRRRARREEKKKRAAKDKHIQVKDPBasic
NLS Segment(s)
PositionSequence
59-76DRRRARREEKKKRAAKDK
343-355RRERRAVGGGVGK
359-365PGGRFKR
Subcellular Location(s) nucl 16, cyto_nucl 12.5, cyto 7, mito 3
Family & Domain DBs
Amino Acid Sequences MCMRENGTYGGHLELSAFAHMERRDVKVVQPGLVYVIEWKAFTKSDEEEDKTLTLTDRDRRRARREEKKKRAAKDKHIQVKDPPAESDSSENDTIYVAYHDWEHFSSIRNLRGPHTGLPYVHETPPPPACTTPSTPAPPPVSTTKPKKKVTLKLPRSGSTTPISNTPTPAPTTPTTATTTVPRNSTLDPTTVPLPSSRAASPPPSFAPTPAPHPLRASHLPSSSPSSSSPSPSADVEGECDGEMDEDIPTPALSPPSSFSSSASTSTSNTGNRSQDAEMDLSHLPTPPSSSGSSPDPDSSPEPSPPPIQMQTQTQPLSKRQLRLQQRQLLRAGGGGGARVMTRRERRAVGGGVGKIVIPGGRFKRGAGGGERTGGVEGGEGEEGEEEWVRNGTGRVDVRGFRELKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.11
5 0.09
6 0.15
7 0.15
8 0.2
9 0.21
10 0.24
11 0.28
12 0.29
13 0.32
14 0.36
15 0.38
16 0.35
17 0.33
18 0.29
19 0.26
20 0.25
21 0.22
22 0.15
23 0.15
24 0.14
25 0.14
26 0.14
27 0.15
28 0.15
29 0.17
30 0.18
31 0.18
32 0.24
33 0.31
34 0.34
35 0.34
36 0.35
37 0.34
38 0.3
39 0.29
40 0.23
41 0.2
42 0.22
43 0.28
44 0.35
45 0.44
46 0.53
47 0.61
48 0.69
49 0.76
50 0.81
51 0.84
52 0.86
53 0.88
54 0.9
55 0.92
56 0.91
57 0.9
58 0.9
59 0.89
60 0.88
61 0.87
62 0.87
63 0.86
64 0.83
65 0.77
66 0.72
67 0.72
68 0.67
69 0.58
70 0.49
71 0.4
72 0.37
73 0.35
74 0.33
75 0.25
76 0.24
77 0.23
78 0.21
79 0.19
80 0.18
81 0.17
82 0.13
83 0.12
84 0.07
85 0.07
86 0.09
87 0.09
88 0.11
89 0.11
90 0.13
91 0.13
92 0.15
93 0.22
94 0.25
95 0.29
96 0.31
97 0.32
98 0.32
99 0.36
100 0.36
101 0.33
102 0.34
103 0.32
104 0.29
105 0.31
106 0.34
107 0.32
108 0.3
109 0.28
110 0.24
111 0.26
112 0.3
113 0.29
114 0.25
115 0.22
116 0.24
117 0.27
118 0.3
119 0.3
120 0.31
121 0.32
122 0.31
123 0.36
124 0.37
125 0.33
126 0.32
127 0.33
128 0.34
129 0.38
130 0.47
131 0.52
132 0.58
133 0.62
134 0.67
135 0.71
136 0.74
137 0.77
138 0.78
139 0.75
140 0.74
141 0.74
142 0.68
143 0.65
144 0.56
145 0.49
146 0.4
147 0.35
148 0.27
149 0.26
150 0.28
151 0.23
152 0.24
153 0.22
154 0.21
155 0.2
156 0.2
157 0.2
158 0.18
159 0.22
160 0.21
161 0.22
162 0.23
163 0.22
164 0.22
165 0.22
166 0.26
167 0.23
168 0.23
169 0.22
170 0.21
171 0.21
172 0.24
173 0.21
174 0.17
175 0.16
176 0.16
177 0.16
178 0.15
179 0.14
180 0.11
181 0.12
182 0.11
183 0.13
184 0.12
185 0.12
186 0.13
187 0.18
188 0.18
189 0.18
190 0.19
191 0.19
192 0.19
193 0.18
194 0.23
195 0.19
196 0.23
197 0.27
198 0.28
199 0.26
200 0.28
201 0.28
202 0.28
203 0.3
204 0.3
205 0.27
206 0.26
207 0.26
208 0.26
209 0.31
210 0.25
211 0.23
212 0.19
213 0.21
214 0.21
215 0.22
216 0.22
217 0.18
218 0.19
219 0.18
220 0.18
221 0.15
222 0.14
223 0.13
224 0.12
225 0.11
226 0.09
227 0.09
228 0.07
229 0.06
230 0.06
231 0.05
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.05
238 0.06
239 0.07
240 0.07
241 0.07
242 0.1
243 0.14
244 0.17
245 0.16
246 0.17
247 0.19
248 0.2
249 0.21
250 0.21
251 0.17
252 0.16
253 0.18
254 0.2
255 0.18
256 0.19
257 0.23
258 0.23
259 0.23
260 0.25
261 0.23
262 0.22
263 0.22
264 0.2
265 0.15
266 0.17
267 0.16
268 0.14
269 0.14
270 0.13
271 0.11
272 0.1
273 0.13
274 0.11
275 0.14
276 0.14
277 0.15
278 0.17
279 0.2
280 0.22
281 0.21
282 0.22
283 0.2
284 0.21
285 0.22
286 0.23
287 0.23
288 0.23
289 0.24
290 0.25
291 0.26
292 0.25
293 0.28
294 0.26
295 0.27
296 0.28
297 0.31
298 0.33
299 0.38
300 0.39
301 0.37
302 0.38
303 0.39
304 0.47
305 0.45
306 0.47
307 0.47
308 0.54
309 0.61
310 0.67
311 0.73
312 0.71
313 0.72
314 0.72
315 0.68
316 0.6
317 0.49
318 0.4
319 0.31
320 0.23
321 0.18
322 0.13
323 0.1
324 0.09
325 0.09
326 0.09
327 0.11
328 0.18
329 0.26
330 0.32
331 0.37
332 0.39
333 0.43
334 0.47
335 0.48
336 0.44
337 0.43
338 0.38
339 0.33
340 0.31
341 0.27
342 0.2
343 0.18
344 0.14
345 0.08
346 0.16
347 0.19
348 0.25
349 0.25
350 0.26
351 0.33
352 0.34
353 0.38
354 0.36
355 0.38
356 0.34
357 0.36
358 0.36
359 0.29
360 0.27
361 0.22
362 0.16
363 0.1
364 0.09
365 0.08
366 0.08
367 0.07
368 0.07
369 0.07
370 0.08
371 0.08
372 0.09
373 0.08
374 0.09
375 0.1
376 0.1
377 0.11
378 0.12
379 0.12
380 0.19
381 0.21
382 0.25
383 0.29
384 0.32
385 0.35
386 0.42