Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6WQ52

Protein Details
Accession A0A0L6WQ52    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRVRRSRAHHARRDVHRASRBasic
74-97ALRTHWRSKAHKRRCKELKQPAYTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRVRRSRAHHARRDVHRASRTRVRSRDLDLIQLIDLDPKNRAALEAQPIDLEKPGLAQHYCVECAKYYETDSALRTHWRSKAHKRRCKELKQPAYTIEEAERAAGLGREGKRTASTSRPLIAPDDAMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.81
3 0.79
4 0.76
5 0.72
6 0.7
7 0.7
8 0.71
9 0.71
10 0.7
11 0.66
12 0.62
13 0.62
14 0.64
15 0.55
16 0.51
17 0.42
18 0.37
19 0.31
20 0.27
21 0.21
22 0.16
23 0.15
24 0.12
25 0.12
26 0.12
27 0.12
28 0.12
29 0.12
30 0.1
31 0.13
32 0.18
33 0.18
34 0.17
35 0.17
36 0.17
37 0.17
38 0.16
39 0.13
40 0.06
41 0.06
42 0.06
43 0.08
44 0.08
45 0.08
46 0.11
47 0.12
48 0.13
49 0.13
50 0.13
51 0.11
52 0.12
53 0.13
54 0.11
55 0.11
56 0.11
57 0.12
58 0.13
59 0.14
60 0.14
61 0.14
62 0.17
63 0.17
64 0.2
65 0.23
66 0.29
67 0.36
68 0.46
69 0.56
70 0.64
71 0.7
72 0.72
73 0.78
74 0.81
75 0.83
76 0.82
77 0.83
78 0.82
79 0.8
80 0.77
81 0.7
82 0.65
83 0.55
84 0.46
85 0.36
86 0.27
87 0.21
88 0.19
89 0.15
90 0.1
91 0.1
92 0.09
93 0.08
94 0.13
95 0.14
96 0.18
97 0.19
98 0.21
99 0.23
100 0.26
101 0.3
102 0.3
103 0.35
104 0.35
105 0.38
106 0.38
107 0.36
108 0.37
109 0.34