Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9TF20

Protein Details
Accession A0A0C9TF20    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21IKTSKQCKEKWSRVRKTYTVVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13.666, cyto 3.5, cyto_nucl 2.666
Family & Domain DBs
Amino Acid Sequences IKTSKQCKEKWSRVRKTYTVVHKLCNTSGLTYSLEHGANIGPQDEAVWDEYIKQNPGAKMFKRKGWCFYDKMKALMPSKGKGSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.8
3 0.76
4 0.74
5 0.73
6 0.72
7 0.64
8 0.6
9 0.56
10 0.55
11 0.49
12 0.44
13 0.34
14 0.25
15 0.24
16 0.21
17 0.18
18 0.15
19 0.16
20 0.15
21 0.14
22 0.12
23 0.11
24 0.09
25 0.08
26 0.08
27 0.08
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.06
34 0.06
35 0.06
36 0.07
37 0.1
38 0.12
39 0.13
40 0.14
41 0.16
42 0.17
43 0.23
44 0.28
45 0.29
46 0.38
47 0.41
48 0.46
49 0.51
50 0.54
51 0.56
52 0.57
53 0.59
54 0.54
55 0.57
56 0.61
57 0.55
58 0.54
59 0.51
60 0.51
61 0.48
62 0.5
63 0.47
64 0.41
65 0.44