Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9U934

Protein Details
Accession A0A0C9U934    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
52-88VEKEEEMRRARKRERKERDKERKKKAPVKAPEKKPSVBasic
187-209ATSTPPPRKKRVAVKKGWKGWVEHydrophilic
NLS Segment(s)
PositionSequence
59-85RRARKRERKERDKERKKKAPVKAPEKK
193-205PRKKRVAVKKGWK
Subcellular Location(s) mito 18.5, mito_nucl 13.333, nucl 7, cyto_nucl 4.833
Family & Domain DBs
Amino Acid Sequences MSLVMSQHTPAFHTHKRQRRTATAVLAGDFDQRPARDVLTSLLNGVGPYKEVEKEEEMRRARKRERKERDKERKKKAPVKAPEKKPSVETLSATMSTPAPPAPSLPSQSVSAPAIQPSSFWRARGTNHRPTIHIATMQRSVSVTPPPMASSPRSTPGPSDWSTTSRTSSKRPRTPDDDEDALEPAVATSTPPPRKKRVAVKKGWKGWVEGSPPPSEKLINLDAVPILQERRTRSGKSFDAIGVGKDSWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.57
3 0.64
4 0.71
5 0.75
6 0.76
7 0.77
8 0.73
9 0.7
10 0.67
11 0.61
12 0.53
13 0.46
14 0.37
15 0.34
16 0.26
17 0.21
18 0.19
19 0.18
20 0.19
21 0.19
22 0.2
23 0.16
24 0.17
25 0.18
26 0.18
27 0.18
28 0.16
29 0.15
30 0.14
31 0.13
32 0.14
33 0.11
34 0.08
35 0.09
36 0.1
37 0.12
38 0.13
39 0.16
40 0.19
41 0.25
42 0.29
43 0.37
44 0.39
45 0.45
46 0.51
47 0.56
48 0.62
49 0.65
50 0.71
51 0.74
52 0.8
53 0.84
54 0.88
55 0.9
56 0.92
57 0.95
58 0.94
59 0.94
60 0.92
61 0.92
62 0.9
63 0.88
64 0.87
65 0.86
66 0.87
67 0.86
68 0.85
69 0.84
70 0.79
71 0.71
72 0.63
73 0.57
74 0.52
75 0.43
76 0.35
77 0.28
78 0.26
79 0.25
80 0.23
81 0.19
82 0.14
83 0.12
84 0.11
85 0.09
86 0.08
87 0.08
88 0.08
89 0.11
90 0.12
91 0.15
92 0.15
93 0.17
94 0.17
95 0.17
96 0.18
97 0.15
98 0.14
99 0.12
100 0.11
101 0.1
102 0.09
103 0.09
104 0.1
105 0.16
106 0.15
107 0.16
108 0.17
109 0.18
110 0.22
111 0.32
112 0.37
113 0.39
114 0.45
115 0.46
116 0.45
117 0.47
118 0.48
119 0.38
120 0.35
121 0.27
122 0.23
123 0.25
124 0.24
125 0.21
126 0.17
127 0.16
128 0.14
129 0.15
130 0.13
131 0.11
132 0.11
133 0.12
134 0.13
135 0.15
136 0.15
137 0.18
138 0.19
139 0.22
140 0.23
141 0.22
142 0.23
143 0.24
144 0.28
145 0.24
146 0.26
147 0.24
148 0.24
149 0.28
150 0.27
151 0.27
152 0.27
153 0.28
154 0.33
155 0.42
156 0.5
157 0.54
158 0.6
159 0.64
160 0.66
161 0.71
162 0.69
163 0.65
164 0.57
165 0.51
166 0.45
167 0.38
168 0.3
169 0.22
170 0.16
171 0.09
172 0.07
173 0.06
174 0.05
175 0.08
176 0.17
177 0.26
178 0.34
179 0.39
180 0.46
181 0.54
182 0.62
183 0.69
184 0.72
185 0.74
186 0.77
187 0.83
188 0.86
189 0.86
190 0.85
191 0.76
192 0.67
193 0.61
194 0.57
195 0.51
196 0.46
197 0.41
198 0.39
199 0.39
200 0.37
201 0.35
202 0.28
203 0.24
204 0.25
205 0.25
206 0.22
207 0.2
208 0.2
209 0.18
210 0.17
211 0.18
212 0.14
213 0.13
214 0.14
215 0.18
216 0.22
217 0.3
218 0.35
219 0.38
220 0.42
221 0.49
222 0.49
223 0.48
224 0.47
225 0.39
226 0.4
227 0.36
228 0.32
229 0.27