Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9SS13

Protein Details
Accession A0A0C9SS13    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-71RDERPRRPTGRVNRPRRRPSQRADQNVVBasic
NLS Segment(s)
PositionSequence
46-62ERPRRPTGRVNRPRRRP
Subcellular Location(s) plas 13, extr 8, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNSTYSCFQSLRGEIFHVVAIVFAILVFLFVVMTDLLPRLAEARDERPRRPTGRVNRPRRRPSQRADQNVVSVASSRRNFGPST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.22
4 0.16
5 0.12
6 0.09
7 0.08
8 0.05
9 0.04
10 0.03
11 0.03
12 0.02
13 0.03
14 0.02
15 0.02
16 0.02
17 0.02
18 0.03
19 0.03
20 0.03
21 0.03
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.05
28 0.07
29 0.09
30 0.15
31 0.24
32 0.28
33 0.29
34 0.34
35 0.4
36 0.41
37 0.45
38 0.49
39 0.5
40 0.58
41 0.67
42 0.73
43 0.77
44 0.85
45 0.88
46 0.89
47 0.88
48 0.85
49 0.82
50 0.82
51 0.82
52 0.8
53 0.78
54 0.7
55 0.63
56 0.56
57 0.49
58 0.38
59 0.31
60 0.24
61 0.25
62 0.23
63 0.24
64 0.24