Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TGK2

Protein Details
Accession A0A0C9TGK2   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MYSTSAQKAKRRTHARPELTDEQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR018247  EF_Hand_1_Ca_BS  
IPR002048  EF_hand_dom  
Gene Ontology GO:0005509  F:calcium ion binding  
Pfam View protein in Pfam  
PF13499  EF-hand_7  
PROSITE View protein in PROSITE  
PS00018  EF_HAND_1  
PS50222  EF_HAND_2  
CDD cd00051  EFh  
Amino Acid Sequences MYSTSAQKAKRRTHARPELTDEQKQEIKEAFELFDTDKDGSLDYHELKVAMRALGFDMKKAEVLKILRDHDKSGHGLMEFEDFAKIMSERILARDPMEEIRRAFQLFDDDNTGKISLRNLRRVAKEIGDRLEDDELQAMIDEFDLDQDGEINEQEFFAIMTDDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.81
4 0.8
5 0.79
6 0.76
7 0.72
8 0.64
9 0.58
10 0.54
11 0.47
12 0.41
13 0.34
14 0.29
15 0.26
16 0.25
17 0.2
18 0.17
19 0.18
20 0.16
21 0.15
22 0.15
23 0.13
24 0.13
25 0.12
26 0.12
27 0.11
28 0.12
29 0.14
30 0.13
31 0.14
32 0.13
33 0.13
34 0.13
35 0.15
36 0.13
37 0.11
38 0.09
39 0.09
40 0.1
41 0.15
42 0.15
43 0.14
44 0.14
45 0.14
46 0.16
47 0.16
48 0.15
49 0.14
50 0.15
51 0.18
52 0.21
53 0.24
54 0.27
55 0.28
56 0.29
57 0.26
58 0.28
59 0.25
60 0.21
61 0.19
62 0.14
63 0.13
64 0.12
65 0.12
66 0.09
67 0.08
68 0.07
69 0.06
70 0.06
71 0.06
72 0.06
73 0.04
74 0.05
75 0.06
76 0.06
77 0.09
78 0.1
79 0.1
80 0.11
81 0.11
82 0.12
83 0.14
84 0.16
85 0.16
86 0.15
87 0.17
88 0.18
89 0.17
90 0.16
91 0.13
92 0.16
93 0.15
94 0.16
95 0.2
96 0.18
97 0.19
98 0.2
99 0.19
100 0.15
101 0.14
102 0.18
103 0.2
104 0.26
105 0.33
106 0.37
107 0.43
108 0.45
109 0.49
110 0.49
111 0.46
112 0.46
113 0.43
114 0.41
115 0.37
116 0.34
117 0.32
118 0.31
119 0.25
120 0.19
121 0.16
122 0.13
123 0.11
124 0.1
125 0.08
126 0.06
127 0.06
128 0.06
129 0.04
130 0.05
131 0.06
132 0.06
133 0.05
134 0.06
135 0.07
136 0.07
137 0.08
138 0.08
139 0.07
140 0.07
141 0.07
142 0.06
143 0.06
144 0.06