Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9TAI4

Protein Details
Accession A0A0C9TAI4    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
21-42AQVRNLKQAGHPEKRRKRELDPBasic
179-198SPCPPPNTSAPKRKNRCGACHydrophilic
NLS Segment(s)
PositionSequence
35-36RR
Subcellular Location(s) nucl 12, cyto 8, pero 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences TSDDPLQPGLTDLKDTLAEAAQVRNLKQAGHPEKRRKRELDPAMDYLINAEKHAGLMCRRKVFDVCFENDAADGWREQTTATVYGWHHLNDMGPSIMMWNATVERIIDCAHHRKITSVPELKRETGWSDADQFGSEIIALVQRHAAPLPTPFVSTPLRLTASGTVNTALPLLLDTAPASPCPPPNTSAPKRKNRCGACGQEGHNARNRTCSKHPSHTATAAGKENVHILFAFLSILS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.12
5 0.14
6 0.13
7 0.14
8 0.16
9 0.18
10 0.19
11 0.22
12 0.22
13 0.21
14 0.23
15 0.33
16 0.39
17 0.47
18 0.56
19 0.62
20 0.72
21 0.8
22 0.86
23 0.81
24 0.78
25 0.78
26 0.78
27 0.77
28 0.73
29 0.66
30 0.6
31 0.55
32 0.47
33 0.38
34 0.33
35 0.23
36 0.17
37 0.15
38 0.12
39 0.12
40 0.14
41 0.15
42 0.16
43 0.24
44 0.3
45 0.34
46 0.35
47 0.37
48 0.39
49 0.39
50 0.42
51 0.39
52 0.37
53 0.34
54 0.33
55 0.31
56 0.27
57 0.25
58 0.17
59 0.12
60 0.09
61 0.08
62 0.09
63 0.08
64 0.08
65 0.09
66 0.1
67 0.1
68 0.1
69 0.13
70 0.13
71 0.15
72 0.16
73 0.15
74 0.14
75 0.12
76 0.13
77 0.09
78 0.1
79 0.08
80 0.07
81 0.06
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.07
95 0.1
96 0.16
97 0.18
98 0.19
99 0.19
100 0.2
101 0.23
102 0.26
103 0.31
104 0.32
105 0.31
106 0.37
107 0.39
108 0.38
109 0.36
110 0.32
111 0.26
112 0.22
113 0.22
114 0.16
115 0.16
116 0.16
117 0.16
118 0.15
119 0.13
120 0.1
121 0.08
122 0.07
123 0.04
124 0.04
125 0.06
126 0.06
127 0.06
128 0.07
129 0.07
130 0.08
131 0.08
132 0.09
133 0.07
134 0.08
135 0.11
136 0.1
137 0.11
138 0.11
139 0.15
140 0.16
141 0.16
142 0.16
143 0.16
144 0.17
145 0.16
146 0.18
147 0.18
148 0.2
149 0.19
150 0.18
151 0.16
152 0.15
153 0.15
154 0.13
155 0.09
156 0.06
157 0.05
158 0.06
159 0.06
160 0.06
161 0.06
162 0.08
163 0.08
164 0.09
165 0.1
166 0.1
167 0.13
168 0.17
169 0.18
170 0.19
171 0.26
172 0.36
173 0.44
174 0.53
175 0.59
176 0.67
177 0.73
178 0.79
179 0.81
180 0.76
181 0.75
182 0.74
183 0.72
184 0.68
185 0.67
186 0.62
187 0.61
188 0.6
189 0.56
190 0.54
191 0.5
192 0.43
193 0.46
194 0.46
195 0.45
196 0.49
197 0.55
198 0.56
199 0.62
200 0.7
201 0.68
202 0.7
203 0.66
204 0.65
205 0.59
206 0.56
207 0.5
208 0.44
209 0.37
210 0.32
211 0.32
212 0.25
213 0.22
214 0.17
215 0.13
216 0.12
217 0.12