Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9TT16

Protein Details
Accession A0A0C9TT16    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
51-70ATRKPIGKVREPKRREKFGDBasic
NLS Segment(s)
PositionSequence
53-66RKPIGKVREPKRRE
Subcellular Location(s) cyto 11, nucl 10, mito 6
Family & Domain DBs
Amino Acid Sequences TLTMEELHARLFHIAPATIRDMLAKGMVEGVKLDPLHETMGQCESCEYAKATRKPIGKVREPKRREKFGDEVHTDLWGPSPTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.16
4 0.18
5 0.16
6 0.16
7 0.15
8 0.14
9 0.13
10 0.14
11 0.1
12 0.07
13 0.09
14 0.09
15 0.09
16 0.09
17 0.09
18 0.1
19 0.1
20 0.1
21 0.08
22 0.09
23 0.11
24 0.11
25 0.11
26 0.09
27 0.12
28 0.12
29 0.11
30 0.1
31 0.1
32 0.09
33 0.1
34 0.1
35 0.13
36 0.21
37 0.24
38 0.29
39 0.34
40 0.37
41 0.41
42 0.48
43 0.51
44 0.52
45 0.59
46 0.65
47 0.7
48 0.72
49 0.78
50 0.79
51 0.81
52 0.77
53 0.74
54 0.73
55 0.71
56 0.76
57 0.69
58 0.62
59 0.53
60 0.49
61 0.42
62 0.33
63 0.26