Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TVL6

Protein Details
Accession A0A0C9TVL6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-66GPKTGKSCREKWKRIRATFHBasic
NLS Segment(s)
Subcellular Location(s) mito 8cyto 8cyto_mito 8, extr 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR024752  Myb/SANT-like_dom  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF12776  Myb_DNA-bind_3  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences WSLADVNVLVDEVIAQQVKAGDGLNFRTSIWNMISACLGLSKPLKGGPKTGKSCREKWKRIRATFHIVDKLAHASGFAYSEALGANISVENQSVWDDYMKTNKDAGPFRNKGWPLYEKMKSVMPSNARGAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.08
5 0.09
6 0.09
7 0.09
8 0.09
9 0.11
10 0.15
11 0.16
12 0.15
13 0.15
14 0.18
15 0.18
16 0.19
17 0.18
18 0.19
19 0.17
20 0.17
21 0.17
22 0.14
23 0.13
24 0.11
25 0.1
26 0.09
27 0.1
28 0.1
29 0.1
30 0.14
31 0.2
32 0.19
33 0.27
34 0.32
35 0.4
36 0.46
37 0.52
38 0.58
39 0.58
40 0.64
41 0.68
42 0.71
43 0.71
44 0.74
45 0.79
46 0.79
47 0.8
48 0.8
49 0.75
50 0.73
51 0.67
52 0.6
53 0.52
54 0.43
55 0.37
56 0.3
57 0.26
58 0.17
59 0.13
60 0.09
61 0.07
62 0.06
63 0.07
64 0.06
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.04
71 0.03
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.06
80 0.06
81 0.07
82 0.07
83 0.09
84 0.1
85 0.18
86 0.19
87 0.2
88 0.22
89 0.23
90 0.29
91 0.33
92 0.37
93 0.4
94 0.41
95 0.42
96 0.49
97 0.48
98 0.45
99 0.46
100 0.45
101 0.41
102 0.47
103 0.49
104 0.43
105 0.44
106 0.46
107 0.42
108 0.41
109 0.42
110 0.38
111 0.39