Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9SU50

Protein Details
Accession A0A0C9SU50    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-72PDAHSKRDSSRDTKRRRRRKKKAPIVSAGGVBasic
NLS Segment(s)
PositionSequence
31-67KDPKKPRIDSLPDAHSKRDSSRDTKRRRRRKKKAPIV
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPSSTRTATPGPSNLTQGPKRPISDAESAPKDPKKPRIDSLPDAHSKRDSSRDTKRRRRRKKKAPIVSAGGVRKESTPSRTEERPLSQRAPLSARSEIIRFSSPAPEADPSTSAMSSAEVPMQGPSSTLLVKNGESPSRSSNDNPNVEHGGETMLSSPMSKKTVVPLDEPVPKPPCNSLEDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.44
4 0.46
5 0.48
6 0.48
7 0.47
8 0.45
9 0.44
10 0.41
11 0.44
12 0.41
13 0.42
14 0.42
15 0.43
16 0.47
17 0.47
18 0.48
19 0.49
20 0.54
21 0.54
22 0.55
23 0.58
24 0.62
25 0.66
26 0.66
27 0.65
28 0.63
29 0.62
30 0.58
31 0.55
32 0.47
33 0.41
34 0.38
35 0.4
36 0.38
37 0.38
38 0.48
39 0.56
40 0.64
41 0.73
42 0.8
43 0.84
44 0.9
45 0.93
46 0.94
47 0.95
48 0.95
49 0.96
50 0.95
51 0.93
52 0.87
53 0.82
54 0.73
55 0.68
56 0.58
57 0.48
58 0.38
59 0.3
60 0.24
61 0.21
62 0.2
63 0.18
64 0.18
65 0.21
66 0.25
67 0.26
68 0.28
69 0.29
70 0.32
71 0.34
72 0.36
73 0.34
74 0.31
75 0.3
76 0.29
77 0.28
78 0.26
79 0.24
80 0.21
81 0.2
82 0.19
83 0.18
84 0.17
85 0.16
86 0.14
87 0.12
88 0.12
89 0.14
90 0.14
91 0.14
92 0.14
93 0.14
94 0.14
95 0.14
96 0.13
97 0.12
98 0.13
99 0.12
100 0.11
101 0.1
102 0.1
103 0.09
104 0.09
105 0.08
106 0.06
107 0.07
108 0.07
109 0.08
110 0.07
111 0.07
112 0.07
113 0.08
114 0.09
115 0.1
116 0.11
117 0.11
118 0.12
119 0.16
120 0.18
121 0.19
122 0.19
123 0.22
124 0.23
125 0.24
126 0.27
127 0.25
128 0.32
129 0.38
130 0.41
131 0.4
132 0.4
133 0.41
134 0.39
135 0.36
136 0.27
137 0.2
138 0.15
139 0.14
140 0.11
141 0.09
142 0.09
143 0.09
144 0.11
145 0.13
146 0.15
147 0.16
148 0.15
149 0.22
150 0.3
151 0.32
152 0.33
153 0.35
154 0.39
155 0.47
156 0.48
157 0.48
158 0.45
159 0.44
160 0.43
161 0.43
162 0.41