Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9T0G4

Protein Details
Accession A0A0C9T0G4    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-82YHQDLHREPRTRKKPNSAKRHEGLBasic
NLS Segment(s)
PositionSequence
67-78PRTRKKPNSAKR
Subcellular Location(s) nucl 16, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MYGHAVFFAQEGRLFMLRAGAHCPASLTSPSAATPASGLAPWLFSCMMNPNGYSNSMPYHQDLHREPRTRKKPNSAKRHEGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.17
4 0.16
5 0.16
6 0.18
7 0.17
8 0.17
9 0.16
10 0.17
11 0.13
12 0.15
13 0.15
14 0.13
15 0.11
16 0.11
17 0.11
18 0.11
19 0.1
20 0.08
21 0.07
22 0.06
23 0.06
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.1
34 0.12
35 0.12
36 0.12
37 0.12
38 0.13
39 0.15
40 0.15
41 0.13
42 0.13
43 0.14
44 0.15
45 0.15
46 0.19
47 0.19
48 0.25
49 0.28
50 0.35
51 0.42
52 0.49
53 0.53
54 0.59
55 0.69
56 0.72
57 0.77
58 0.79
59 0.81
60 0.84
61 0.9
62 0.89