Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TV23

Protein Details
Accession A0A0C9TV23   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
102-131KRPETRPGMTRKVRRPGRSKGCRTRGRNEEBasic
NLS Segment(s)
PositionSequence
103-126RPETRPGMTRKVRRPGRSKGCRTR
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MVAMRVSATRTSYPTRPYHLPTTSLPPPPDEPASKPPLSGYVNEMATHLEHPQQELSTMQPRRMPYDEISNGEGGGEAASGDNEVEGSEDDQSTSNGVDEGKRPETRPGMTRKVRRPGRSKGCRTRGRNEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.45
4 0.48
5 0.52
6 0.49
7 0.48
8 0.44
9 0.47
10 0.47
11 0.47
12 0.43
13 0.38
14 0.38
15 0.38
16 0.4
17 0.35
18 0.34
19 0.35
20 0.41
21 0.37
22 0.35
23 0.31
24 0.33
25 0.31
26 0.27
27 0.24
28 0.21
29 0.22
30 0.22
31 0.22
32 0.16
33 0.15
34 0.15
35 0.12
36 0.11
37 0.11
38 0.11
39 0.12
40 0.11
41 0.11
42 0.11
43 0.13
44 0.18
45 0.18
46 0.19
47 0.22
48 0.22
49 0.26
50 0.27
51 0.27
52 0.2
53 0.28
54 0.28
55 0.27
56 0.28
57 0.23
58 0.21
59 0.18
60 0.17
61 0.08
62 0.06
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.04
75 0.05
76 0.05
77 0.06
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.08
86 0.11
87 0.16
88 0.22
89 0.24
90 0.25
91 0.31
92 0.36
93 0.38
94 0.42
95 0.45
96 0.5
97 0.57
98 0.65
99 0.67
100 0.73
101 0.78
102 0.8
103 0.8
104 0.81
105 0.83
106 0.85
107 0.86
108 0.87
109 0.88
110 0.89
111 0.88