Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TBF1

Protein Details
Accession A0A0C9TBF1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MQKKLIEHSKRRRTRASEQPTKRHDVBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MQKKLIEHSKRRRTRASEQPTKRHDVFYASVEVQECKKAPSRTVKILIRRQSVASPTPPTRARHWPCQLTRDLSRCTISSELKRAGSLERRASLTEGNVKGWRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.81
4 0.81
5 0.81
6 0.84
7 0.8
8 0.8
9 0.71
10 0.63
11 0.53
12 0.47
13 0.4
14 0.33
15 0.32
16 0.24
17 0.24
18 0.22
19 0.22
20 0.18
21 0.18
22 0.16
23 0.14
24 0.2
25 0.21
26 0.25
27 0.34
28 0.39
29 0.42
30 0.49
31 0.52
32 0.54
33 0.6
34 0.62
35 0.54
36 0.5
37 0.45
38 0.4
39 0.37
40 0.31
41 0.26
42 0.24
43 0.23
44 0.27
45 0.3
46 0.3
47 0.33
48 0.41
49 0.43
50 0.48
51 0.54
52 0.58
53 0.56
54 0.59
55 0.58
56 0.52
57 0.54
58 0.49
59 0.45
60 0.39
61 0.38
62 0.33
63 0.33
64 0.31
65 0.31
66 0.31
67 0.34
68 0.36
69 0.34
70 0.34
71 0.32
72 0.34
73 0.37
74 0.39
75 0.39
76 0.38
77 0.39
78 0.4
79 0.41
80 0.37
81 0.34
82 0.36
83 0.31
84 0.32