Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9TAU6

Protein Details
Accession A0A0C9TAU6    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
48-75ILSRHLRGPYRNRRPKRLQRPQPLGPPHBasic
NLS Segment(s)
PositionSequence
56-68PYRNRRPKRLQRP
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MAGTVIKRVRFALVDGMDIDHAQGSSDASTSDEESASSGEDIDMSSPILSRHLRGPYRNRRPKRLQRPQPLGPPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.2
4 0.18
5 0.17
6 0.15
7 0.08
8 0.07
9 0.06
10 0.06
11 0.05
12 0.05
13 0.05
14 0.05
15 0.06
16 0.07
17 0.07
18 0.08
19 0.07
20 0.07
21 0.07
22 0.07
23 0.06
24 0.06
25 0.05
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.05
35 0.09
36 0.09
37 0.1
38 0.16
39 0.23
40 0.28
41 0.35
42 0.45
43 0.53
44 0.64
45 0.73
46 0.76
47 0.78
48 0.85
49 0.9
50 0.9
51 0.91
52 0.9
53 0.91
54 0.92
55 0.9