Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9SLX8

Protein Details
Accession A0A0C9SLX8    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22QPGPKDIYKRLKKQCENMKIESHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 9, nucl 6.5, mito 6, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004443  YjeF_N_dom  
IPR036652  YjeF_N_dom_sf  
IPR032976  YJEFN_prot_NAXE-like  
Pfam View protein in Pfam  
PF03853  YjeF_N  
PROSITE View protein in PROSITE  
PS51385  YJEF_N  
Amino Acid Sequences QPGPKDIYKRLKKQCENMKIESLPHDASMDTLRSTLSSSDVILDAIFGFSFKGPVRAPFNEVLPLLSSARKPIVSVDIPSGWDVEKGNEEGMGIVPDVLVSLTAPKEGVRSFKGRHFLGGRFVPKAMEEKFQFNLPEYPGFDQIVELPQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.83
4 0.78
5 0.75
6 0.66
7 0.6
8 0.54
9 0.47
10 0.37
11 0.31
12 0.26
13 0.19
14 0.18
15 0.18
16 0.15
17 0.12
18 0.11
19 0.1
20 0.1
21 0.11
22 0.1
23 0.1
24 0.09
25 0.09
26 0.1
27 0.1
28 0.1
29 0.08
30 0.08
31 0.06
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.06
38 0.06
39 0.1
40 0.1
41 0.15
42 0.21
43 0.21
44 0.25
45 0.24
46 0.25
47 0.23
48 0.23
49 0.19
50 0.14
51 0.14
52 0.12
53 0.12
54 0.11
55 0.1
56 0.11
57 0.11
58 0.1
59 0.1
60 0.13
61 0.13
62 0.14
63 0.14
64 0.13
65 0.14
66 0.14
67 0.13
68 0.09
69 0.09
70 0.08
71 0.07
72 0.08
73 0.08
74 0.08
75 0.08
76 0.07
77 0.07
78 0.07
79 0.06
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.03
86 0.03
87 0.02
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.08
94 0.09
95 0.13
96 0.15
97 0.21
98 0.23
99 0.29
100 0.35
101 0.34
102 0.39
103 0.39
104 0.37
105 0.39
106 0.43
107 0.4
108 0.35
109 0.35
110 0.3
111 0.27
112 0.31
113 0.26
114 0.27
115 0.26
116 0.29
117 0.3
118 0.33
119 0.33
120 0.3
121 0.32
122 0.27
123 0.29
124 0.28
125 0.3
126 0.29
127 0.28
128 0.25
129 0.22
130 0.21