Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TGT7

Protein Details
Accession A0A0C9TGT7    Localization Confidence High Confidence Score 19.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPHKRAKRSVRERGKALQDTBasic
61-82NDEDNPRSKKRRHNEADRNVDGBasic
NLS Segment(s)
PositionSequence
5-12RAKRSVRE
44-60GKIRREYREKKRKLGGD
65-72NPRSKKRR
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MPHKRAKRSVRERGKALQDTDLAPKIAIEREPIPKSVSRVLDAGKIRREYREKKRKLGGDNDEDNPRSKKRRHNEADRNVDGQTKELKIKPGETVAHFNKRVETTMMPLIKTALQQSSAQERKVWKEESSQEALKPDKNSHNKSRHQPPETSKEISVPPPAACAGEGSVKRTFSATKEFQVTSTSAPCRLNDIAQEPPEIKKIPRGATKSDRTTGVLSMAQKAMMEEEREKAIKHYRELKARKYANPVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.77
3 0.69
4 0.63
5 0.54
6 0.48
7 0.48
8 0.42
9 0.33
10 0.26
11 0.24
12 0.21
13 0.22
14 0.2
15 0.18
16 0.2
17 0.28
18 0.31
19 0.32
20 0.33
21 0.33
22 0.36
23 0.39
24 0.37
25 0.31
26 0.31
27 0.31
28 0.35
29 0.37
30 0.39
31 0.38
32 0.4
33 0.4
34 0.45
35 0.53
36 0.56
37 0.62
38 0.67
39 0.68
40 0.71
41 0.79
42 0.78
43 0.76
44 0.77
45 0.74
46 0.72
47 0.7
48 0.65
49 0.61
50 0.55
51 0.51
52 0.45
53 0.42
54 0.41
55 0.43
56 0.49
57 0.53
58 0.64
59 0.7
60 0.77
61 0.82
62 0.84
63 0.87
64 0.8
65 0.72
66 0.61
67 0.55
68 0.44
69 0.35
70 0.29
71 0.21
72 0.22
73 0.22
74 0.27
75 0.25
76 0.26
77 0.26
78 0.26
79 0.27
80 0.25
81 0.31
82 0.31
83 0.37
84 0.37
85 0.36
86 0.34
87 0.32
88 0.31
89 0.26
90 0.21
91 0.17
92 0.22
93 0.23
94 0.19
95 0.18
96 0.18
97 0.16
98 0.16
99 0.15
100 0.09
101 0.1
102 0.11
103 0.12
104 0.21
105 0.22
106 0.22
107 0.23
108 0.24
109 0.26
110 0.3
111 0.31
112 0.23
113 0.26
114 0.29
115 0.31
116 0.33
117 0.3
118 0.26
119 0.28
120 0.28
121 0.26
122 0.24
123 0.24
124 0.28
125 0.36
126 0.42
127 0.48
128 0.56
129 0.59
130 0.66
131 0.72
132 0.72
133 0.68
134 0.67
135 0.64
136 0.62
137 0.6
138 0.55
139 0.45
140 0.38
141 0.36
142 0.32
143 0.29
144 0.23
145 0.19
146 0.17
147 0.17
148 0.14
149 0.12
150 0.11
151 0.09
152 0.13
153 0.14
154 0.16
155 0.18
156 0.18
157 0.18
158 0.19
159 0.19
160 0.16
161 0.24
162 0.23
163 0.24
164 0.28
165 0.28
166 0.28
167 0.29
168 0.27
169 0.21
170 0.24
171 0.22
172 0.22
173 0.23
174 0.23
175 0.26
176 0.26
177 0.25
178 0.22
179 0.24
180 0.26
181 0.26
182 0.27
183 0.24
184 0.24
185 0.27
186 0.26
187 0.23
188 0.25
189 0.3
190 0.36
191 0.42
192 0.45
193 0.49
194 0.57
195 0.65
196 0.64
197 0.61
198 0.56
199 0.5
200 0.48
201 0.4
202 0.34
203 0.29
204 0.24
205 0.24
206 0.22
207 0.2
208 0.18
209 0.17
210 0.17
211 0.16
212 0.19
213 0.17
214 0.19
215 0.24
216 0.25
217 0.25
218 0.27
219 0.34
220 0.36
221 0.42
222 0.49
223 0.53
224 0.62
225 0.7
226 0.73
227 0.74
228 0.75
229 0.74