Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9SU21

Protein Details
Accession A0A0C9SU21   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
42-72PDAHSKRDSSRDTKRRRRRKKKAPIVSAGGABasic
NLS Segment(s)
PositionSequence
31-74KDPKKPRIEPLPDAHSKRDSSRDTKRRRRRKKKAPIVSAGGARK
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MPSSTRTATPGPSNLTQCPKRPISDAEFAPKDPKKPRIEPLPDAHSKRDSSRDTKRRRRRKKKAPIVSAGGARKESTPSRTEERPLSQRAPLSARSEIIRFSSPAPEADPSTSAMSSAEVPMQGPSSTLLVKNGESPSRSSNDNPNVEHGGETMLSSPMSKKTVVPLDEPVPKPPCNSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.5
3 0.51
4 0.51
5 0.54
6 0.52
7 0.49
8 0.5
9 0.5
10 0.47
11 0.5
12 0.47
13 0.48
14 0.46
15 0.45
16 0.49
17 0.45
18 0.46
19 0.45
20 0.51
21 0.51
22 0.54
23 0.61
24 0.64
25 0.69
26 0.68
27 0.68
28 0.67
29 0.66
30 0.63
31 0.59
32 0.52
33 0.47
34 0.44
35 0.45
36 0.42
37 0.42
38 0.5
39 0.57
40 0.63
41 0.73
42 0.8
43 0.83
44 0.9
45 0.93
46 0.94
47 0.95
48 0.95
49 0.95
50 0.95
51 0.92
52 0.87
53 0.81
54 0.73
55 0.67
56 0.58
57 0.48
58 0.38
59 0.29
60 0.23
61 0.21
62 0.2
63 0.18
64 0.18
65 0.2
66 0.25
67 0.26
68 0.28
69 0.29
70 0.32
71 0.33
72 0.35
73 0.33
74 0.31
75 0.3
76 0.29
77 0.28
78 0.26
79 0.24
80 0.21
81 0.2
82 0.19
83 0.18
84 0.17
85 0.16
86 0.15
87 0.12
88 0.12
89 0.14
90 0.14
91 0.14
92 0.15
93 0.14
94 0.14
95 0.14
96 0.14
97 0.13
98 0.13
99 0.12
100 0.11
101 0.1
102 0.1
103 0.09
104 0.09
105 0.08
106 0.06
107 0.07
108 0.07
109 0.08
110 0.07
111 0.07
112 0.07
113 0.08
114 0.1
115 0.1
116 0.11
117 0.12
118 0.12
119 0.16
120 0.18
121 0.19
122 0.2
123 0.22
124 0.24
125 0.25
126 0.27
127 0.26
128 0.32
129 0.38
130 0.42
131 0.4
132 0.41
133 0.41
134 0.39
135 0.36
136 0.27
137 0.2
138 0.15
139 0.15
140 0.11
141 0.09
142 0.09
143 0.09
144 0.11
145 0.13
146 0.15
147 0.16
148 0.16
149 0.23
150 0.3
151 0.32
152 0.34
153 0.35
154 0.4
155 0.48
156 0.49
157 0.48
158 0.46
159 0.44