Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TZP7

Protein Details
Accession A0A0C9TZP7   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
107-135QRAMPRGPMFPRRRRRRARRTQVEGTSNQHydrophilic
NLS Segment(s)
PositionSequence
114-126PMFPRRRRRRARR
Subcellular Location(s) mito 12, nucl 10, cyto_nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
Amino Acid Sequences MGQVTPVPQPSPQLQPRSASRLSFLSTSRPQLRSAEIPKPSKSDLIRAYTLQHAESGLGNDYLKRKNVIRVRLEGEQFLLQAHDVPAVVGWIEGIHAGTNIALDLDQRAMPRGPMFPRRRRRRARRTQVEGTSNQVQAPTIISSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.5
4 0.53
5 0.52
6 0.43
7 0.39
8 0.35
9 0.34
10 0.32
11 0.28
12 0.28
13 0.29
14 0.36
15 0.4
16 0.38
17 0.38
18 0.37
19 0.41
20 0.41
21 0.43
22 0.43
23 0.44
24 0.47
25 0.47
26 0.48
27 0.45
28 0.43
29 0.38
30 0.38
31 0.36
32 0.36
33 0.36
34 0.33
35 0.34
36 0.31
37 0.31
38 0.24
39 0.19
40 0.14
41 0.12
42 0.12
43 0.11
44 0.08
45 0.08
46 0.08
47 0.09
48 0.12
49 0.14
50 0.14
51 0.16
52 0.16
53 0.23
54 0.29
55 0.35
56 0.35
57 0.37
58 0.4
59 0.42
60 0.41
61 0.33
62 0.29
63 0.21
64 0.18
65 0.14
66 0.1
67 0.06
68 0.06
69 0.06
70 0.05
71 0.05
72 0.04
73 0.04
74 0.04
75 0.04
76 0.03
77 0.03
78 0.02
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.06
93 0.07
94 0.07
95 0.1
96 0.1
97 0.11
98 0.13
99 0.17
100 0.22
101 0.31
102 0.4
103 0.48
104 0.59
105 0.69
106 0.78
107 0.85
108 0.9
109 0.91
110 0.93
111 0.95
112 0.95
113 0.93
114 0.92
115 0.89
116 0.85
117 0.75
118 0.7
119 0.65
120 0.54
121 0.46
122 0.36
123 0.28
124 0.22
125 0.22