Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9SX34

Protein Details
Accession A0A0C9SX34   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-48MHAVPRRPQQHQGRLKKHGRKPAKKKQADSHARKKRKETSPRSPQASPBasic
NLS Segment(s)
PositionSequence
11-39HQGRLKKHGRKPAKKKQADSHARKKRKET
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MHAVPRRPQQHQGRLKKHGRKPAKKKQADSHARKKRKETSPRSPQASPQVNDKESDNSHPDKESHTPPQHQPSPLGTENEHDAVEPQRSPTPSAEPPYEEPTDPERLPTPSPLECHLTPPFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.88
4 0.85
5 0.85
6 0.86
7 0.86
8 0.88
9 0.89
10 0.9
11 0.88
12 0.88
13 0.87
14 0.87
15 0.87
16 0.85
17 0.85
18 0.85
19 0.86
20 0.82
21 0.81
22 0.8
23 0.79
24 0.8
25 0.79
26 0.79
27 0.81
28 0.84
29 0.82
30 0.73
31 0.67
32 0.65
33 0.64
34 0.53
35 0.5
36 0.48
37 0.43
38 0.43
39 0.39
40 0.33
41 0.26
42 0.29
43 0.25
44 0.21
45 0.21
46 0.22
47 0.21
48 0.2
49 0.23
50 0.24
51 0.29
52 0.31
53 0.34
54 0.37
55 0.45
56 0.46
57 0.43
58 0.41
59 0.35
60 0.37
61 0.35
62 0.33
63 0.25
64 0.22
65 0.23
66 0.22
67 0.2
68 0.13
69 0.12
70 0.12
71 0.14
72 0.13
73 0.13
74 0.16
75 0.17
76 0.2
77 0.21
78 0.25
79 0.28
80 0.32
81 0.32
82 0.32
83 0.35
84 0.38
85 0.38
86 0.32
87 0.3
88 0.3
89 0.34
90 0.3
91 0.29
92 0.27
93 0.28
94 0.3
95 0.31
96 0.32
97 0.29
98 0.32
99 0.32
100 0.36
101 0.33
102 0.37