Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TB40

Protein Details
Accession A0A0C9TB40    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-114KGEEKAKWTRQLRQKVQKMLAKRKKAHydrophilic
NLS Segment(s)
PositionSequence
95-114KWTRQLRQKVQKMLAKRKKA
Subcellular Location(s) nucl 16, cyto 4, pero 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MNDEVLADHTSQYAHSTKSWNGYGSDGDVADREINPPPRRPSEASSIRNFLDRPAVIPVRAPTPPDPFYSNFFKQDTPPDTPSRVEDHKGEEKAKWTRQLRQKVQKMLAKRKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.2
4 0.22
5 0.28
6 0.3
7 0.28
8 0.26
9 0.26
10 0.25
11 0.23
12 0.21
13 0.15
14 0.13
15 0.12
16 0.12
17 0.11
18 0.1
19 0.1
20 0.14
21 0.22
22 0.25
23 0.31
24 0.35
25 0.39
26 0.44
27 0.46
28 0.44
29 0.45
30 0.52
31 0.51
32 0.49
33 0.47
34 0.42
35 0.41
36 0.37
37 0.28
38 0.23
39 0.18
40 0.16
41 0.18
42 0.18
43 0.16
44 0.17
45 0.17
46 0.15
47 0.15
48 0.16
49 0.14
50 0.19
51 0.21
52 0.22
53 0.24
54 0.24
55 0.27
56 0.32
57 0.32
58 0.3
59 0.3
60 0.28
61 0.27
62 0.33
63 0.34
64 0.32
65 0.34
66 0.34
67 0.35
68 0.35
69 0.36
70 0.34
71 0.33
72 0.3
73 0.28
74 0.32
75 0.37
76 0.4
77 0.4
78 0.36
79 0.4
80 0.46
81 0.49
82 0.52
83 0.49
84 0.55
85 0.62
86 0.71
87 0.74
88 0.77
89 0.8
90 0.8
91 0.84
92 0.81
93 0.82
94 0.82