Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9TQG0

Protein Details
Accession A0A0C9TQG0    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-30VQNSRIKKELNRKTKPRYTGPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
Amino Acid Sequences DFSPGSLVLVQNSRIKKELNRKTKPRYTGPMIVLCRTTSGSYLLAKLDRSVSKLCFAAFRLLPYHPRSTLRIALTTITGLDKEALDHLAGIEDNEPDDEEQVLMTSNSPYRQQTQSLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.36
4 0.44
5 0.51
6 0.56
7 0.64
8 0.71
9 0.79
10 0.84
11 0.83
12 0.8
13 0.77
14 0.74
15 0.71
16 0.66
17 0.64
18 0.58
19 0.52
20 0.45
21 0.37
22 0.31
23 0.24
24 0.2
25 0.13
26 0.13
27 0.13
28 0.13
29 0.13
30 0.13
31 0.13
32 0.13
33 0.12
34 0.14
35 0.13
36 0.15
37 0.17
38 0.16
39 0.17
40 0.18
41 0.17
42 0.15
43 0.15
44 0.17
45 0.14
46 0.15
47 0.15
48 0.15
49 0.19
50 0.21
51 0.23
52 0.21
53 0.23
54 0.24
55 0.26
56 0.31
57 0.28
58 0.26
59 0.24
60 0.22
61 0.2
62 0.18
63 0.14
64 0.09
65 0.08
66 0.07
67 0.07
68 0.06
69 0.06
70 0.07
71 0.07
72 0.07
73 0.07
74 0.06
75 0.06
76 0.06
77 0.06
78 0.07
79 0.06
80 0.07
81 0.07
82 0.08
83 0.07
84 0.08
85 0.08
86 0.07
87 0.07
88 0.07
89 0.07
90 0.07
91 0.07
92 0.09
93 0.12
94 0.14
95 0.18
96 0.21
97 0.25
98 0.29