Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TA59

Protein Details
Accession A0A0C9TA59    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
54-73GTNSRCKANRARKLGWKPKFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 26
Family & Domain DBs
Amino Acid Sequences VADLYIILYDAIREGKAGHGREGLYFGENGEHRLRDIAVSIAEALHDLGLPFLGTNSRCKANRARKLGWKPKFTTEDMLKSIKGEVEWQLEHKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.14
3 0.2
4 0.22
5 0.22
6 0.24
7 0.25
8 0.25
9 0.27
10 0.21
11 0.16
12 0.14
13 0.12
14 0.14
15 0.13
16 0.16
17 0.16
18 0.15
19 0.14
20 0.15
21 0.15
22 0.11
23 0.11
24 0.09
25 0.07
26 0.07
27 0.07
28 0.06
29 0.05
30 0.05
31 0.04
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.02
39 0.03
40 0.05
41 0.06
42 0.09
43 0.12
44 0.17
45 0.18
46 0.22
47 0.32
48 0.41
49 0.49
50 0.54
51 0.58
52 0.63
53 0.73
54 0.8
55 0.79
56 0.76
57 0.71
58 0.71
59 0.7
60 0.63
61 0.6
62 0.56
63 0.53
64 0.49
65 0.48
66 0.4
67 0.35
68 0.34
69 0.27
70 0.21
71 0.18
72 0.19
73 0.22
74 0.23