Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9T986

Protein Details
Accession A0A0C9T986   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
65-97WSCAKITRSKEKRVGKRKESKKAIKKRLDSIPYHydrophilic
NLS Segment(s)
PositionSequence
72-91RSKEKRVGKRKESKKAIKKR
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MIETNGQMGSTFSHSPQVAKRVIAKPPIPPKPLGLRLHRQIIQFTLTAVLESRNACPRPDSLPLWSCAKITRSKEKRVGKRKESKKAIKKRLDSIPYMKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.26
4 0.3
5 0.28
6 0.29
7 0.36
8 0.35
9 0.4
10 0.44
11 0.42
12 0.44
13 0.52
14 0.58
15 0.53
16 0.49
17 0.48
18 0.49
19 0.56
20 0.53
21 0.5
22 0.49
23 0.51
24 0.56
25 0.55
26 0.47
27 0.4
28 0.35
29 0.31
30 0.23
31 0.19
32 0.14
33 0.1
34 0.09
35 0.09
36 0.08
37 0.07
38 0.08
39 0.1
40 0.15
41 0.16
42 0.16
43 0.17
44 0.18
45 0.21
46 0.25
47 0.25
48 0.24
49 0.26
50 0.28
51 0.3
52 0.29
53 0.26
54 0.24
55 0.25
56 0.27
57 0.31
58 0.4
59 0.43
60 0.51
61 0.6
62 0.67
63 0.75
64 0.78
65 0.83
66 0.82
67 0.86
68 0.88
69 0.89
70 0.9
71 0.9
72 0.91
73 0.91
74 0.91
75 0.91
76 0.87
77 0.85
78 0.84
79 0.79
80 0.75