Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SFY7

Protein Details
Accession R7SFY7   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
74-101AYRILLRYDRKSRHRRIKKQPSNSEGLKHydrophilic
NLS Segment(s)
PositionSequence
83-94RKSRHRRIKKQP
Subcellular Location(s) nucl 18, cyto_nucl 14.5, cyto 9
Family & Domain DBs
KEGG fme:FOMMEDRAFT_100095  -  
fme:FOMMEDRAFT_95236  -  
Amino Acid Sequences PDVVHEPKLYFNTTHMCRTNIIVSGTDSGLEAFSHNPADDSFAPLPTRTGANTKYLNERFLSSRSLLVGEQSNAYRILLRYDRKSRHRRIKKQPSNSEGLKDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.35
4 0.34
5 0.36
6 0.36
7 0.3
8 0.28
9 0.21
10 0.2
11 0.21
12 0.19
13 0.16
14 0.13
15 0.1
16 0.09
17 0.08
18 0.07
19 0.06
20 0.07
21 0.08
22 0.07
23 0.08
24 0.07
25 0.12
26 0.11
27 0.16
28 0.15
29 0.16
30 0.17
31 0.16
32 0.17
33 0.13
34 0.13
35 0.09
36 0.12
37 0.12
38 0.16
39 0.18
40 0.19
41 0.27
42 0.27
43 0.28
44 0.25
45 0.26
46 0.23
47 0.23
48 0.24
49 0.16
50 0.16
51 0.15
52 0.16
53 0.14
54 0.13
55 0.14
56 0.12
57 0.13
58 0.12
59 0.13
60 0.12
61 0.12
62 0.13
63 0.11
64 0.16
65 0.21
66 0.26
67 0.33
68 0.42
69 0.51
70 0.59
71 0.69
72 0.74
73 0.79
74 0.86
75 0.88
76 0.9
77 0.93
78 0.94
79 0.94
80 0.94
81 0.89
82 0.86
83 0.79