Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SFN8

Protein Details
Accession R7SFN8    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
55-82SRSKTGCLTCRKKRIKCDEVKPICRRCDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG fme:FOMMEDRAFT_162921  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSSSLPYPILYLTPPSPQYTLPADPHEVQIPDAVYTVSPAQIRAEQSQRKRPKYSRSKTGCLTCRKKRIKCDEVKPICRRCDYGQRECTWPDLTNSKKKVQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.24
4 0.24
5 0.26
6 0.28
7 0.3
8 0.28
9 0.29
10 0.31
11 0.3
12 0.32
13 0.31
14 0.26
15 0.22
16 0.2
17 0.17
18 0.13
19 0.13
20 0.11
21 0.07
22 0.08
23 0.08
24 0.09
25 0.08
26 0.08
27 0.09
28 0.12
29 0.14
30 0.16
31 0.23
32 0.28
33 0.33
34 0.43
35 0.5
36 0.53
37 0.58
38 0.61
39 0.64
40 0.69
41 0.71
42 0.71
43 0.7
44 0.7
45 0.68
46 0.71
47 0.68
48 0.67
49 0.69
50 0.67
51 0.7
52 0.74
53 0.75
54 0.77
55 0.8
56 0.8
57 0.81
58 0.81
59 0.82
60 0.82
61 0.85
62 0.84
63 0.81
64 0.75
65 0.69
66 0.64
67 0.59
68 0.6
69 0.59
70 0.6
71 0.6
72 0.59
73 0.6
74 0.57
75 0.55
76 0.47
77 0.41
78 0.35
79 0.37
80 0.41
81 0.47
82 0.51