Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SGM5

Protein Details
Accession R7SGM5   
Localization Confidence High
Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
194-221IPCPPLTKSKARKRRGHGWSRKKASRSGBasic
NLS Segment(s)
PositionSequence
201-239KSKARKRRGHGWSRKKASRSGPSKNSEGRATPTSKKRRI
Subcellular Location(s) nucl 24, mito 1, cyto 1, plas 1, cyto_mito 1
Family & Domain DBs
KEGG fme:FOMMEDRAFT_163262  -  
Amino Acid Sequences MCLDEVIPIVRAYKERGSQFQQVNFPRCPPTTRNSPRPALPSSNAASAASRIMVFTRGMMKRLPAAETRINEADSNEMLAQPRRSALGVSRNNTQAITGRSTPVFDDAAEGSVDDYANAFSTNTGSHGALQLNIIREDQSSSAGARFSDLQTAQAAQVSEANSERNAEAFESREPQGSGLSTEESQNHCEGLDIPCPPLTKSKARKRRGHGWSRKKASRSGPSKNSEGRATPTSKKRRIGEADAEDHELRPRKQQRVTELVEGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.41
4 0.46
5 0.52
6 0.56
7 0.58
8 0.6
9 0.61
10 0.62
11 0.57
12 0.55
13 0.52
14 0.48
15 0.48
16 0.43
17 0.42
18 0.47
19 0.54
20 0.61
21 0.62
22 0.65
23 0.65
24 0.66
25 0.65
26 0.6
27 0.52
28 0.48
29 0.43
30 0.41
31 0.36
32 0.31
33 0.26
34 0.21
35 0.19
36 0.14
37 0.11
38 0.09
39 0.09
40 0.1
41 0.09
42 0.1
43 0.18
44 0.18
45 0.2
46 0.21
47 0.21
48 0.24
49 0.25
50 0.26
51 0.2
52 0.25
53 0.29
54 0.29
55 0.33
56 0.3
57 0.3
58 0.28
59 0.25
60 0.22
61 0.16
62 0.17
63 0.12
64 0.11
65 0.12
66 0.15
67 0.15
68 0.13
69 0.14
70 0.13
71 0.13
72 0.13
73 0.16
74 0.23
75 0.28
76 0.3
77 0.33
78 0.34
79 0.34
80 0.33
81 0.29
82 0.23
83 0.2
84 0.21
85 0.18
86 0.18
87 0.18
88 0.19
89 0.18
90 0.16
91 0.14
92 0.1
93 0.1
94 0.09
95 0.1
96 0.09
97 0.09
98 0.07
99 0.07
100 0.06
101 0.05
102 0.05
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.05
110 0.06
111 0.07
112 0.07
113 0.07
114 0.09
115 0.09
116 0.09
117 0.09
118 0.1
119 0.1
120 0.1
121 0.1
122 0.08
123 0.08
124 0.09
125 0.09
126 0.08
127 0.08
128 0.08
129 0.08
130 0.08
131 0.08
132 0.08
133 0.09
134 0.08
135 0.1
136 0.1
137 0.1
138 0.1
139 0.11
140 0.1
141 0.11
142 0.1
143 0.07
144 0.1
145 0.09
146 0.1
147 0.1
148 0.11
149 0.09
150 0.1
151 0.1
152 0.08
153 0.08
154 0.08
155 0.08
156 0.09
157 0.11
158 0.13
159 0.14
160 0.15
161 0.15
162 0.14
163 0.14
164 0.13
165 0.13
166 0.11
167 0.12
168 0.1
169 0.12
170 0.15
171 0.16
172 0.17
173 0.17
174 0.15
175 0.14
176 0.14
177 0.14
178 0.14
179 0.15
180 0.14
181 0.15
182 0.17
183 0.18
184 0.19
185 0.24
186 0.26
187 0.32
188 0.42
189 0.52
190 0.6
191 0.69
192 0.77
193 0.79
194 0.84
195 0.85
196 0.86
197 0.86
198 0.87
199 0.88
200 0.89
201 0.88
202 0.81
203 0.77
204 0.76
205 0.75
206 0.73
207 0.72
208 0.71
209 0.69
210 0.73
211 0.71
212 0.66
213 0.59
214 0.53
215 0.48
216 0.45
217 0.46
218 0.48
219 0.53
220 0.59
221 0.63
222 0.68
223 0.67
224 0.7
225 0.72
226 0.72
227 0.71
228 0.68
229 0.66
230 0.6
231 0.61
232 0.52
233 0.45
234 0.44
235 0.41
236 0.35
237 0.39
238 0.46
239 0.49
240 0.57
241 0.63
242 0.65
243 0.68
244 0.72