Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SGV6

Protein Details
Accession R7SGV6    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-34ASDIQTREVKRKNPKPCSRCSDMRKKCDTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 15, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG fme:FOMMEDRAFT_32416  -  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences METGVASDIQTREVKRKNPKPCSRCSDMRKKCDTSPPYSLARCRECTRANIPTCPPHRPRRSKGSSHPSISPNVASPNLPGSIDTSATPIGFTITEAGSGYTQESLFRLNELESEVVTDFWNLMLPTLLAPAFGPAYLPTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.6
4 0.67
5 0.74
6 0.83
7 0.81
8 0.84
9 0.84
10 0.81
11 0.81
12 0.8
13 0.8
14 0.79
15 0.81
16 0.79
17 0.76
18 0.73
19 0.73
20 0.69
21 0.64
22 0.61
23 0.56
24 0.54
25 0.52
26 0.51
27 0.48
28 0.48
29 0.46
30 0.43
31 0.45
32 0.42
33 0.44
34 0.46
35 0.48
36 0.45
37 0.45
38 0.45
39 0.46
40 0.47
41 0.49
42 0.49
43 0.51
44 0.58
45 0.63
46 0.66
47 0.68
48 0.72
49 0.72
50 0.75
51 0.75
52 0.71
53 0.65
54 0.63
55 0.54
56 0.49
57 0.42
58 0.33
59 0.24
60 0.19
61 0.16
62 0.12
63 0.11
64 0.11
65 0.1
66 0.1
67 0.09
68 0.09
69 0.09
70 0.1
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.07
77 0.07
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.07
91 0.08
92 0.09
93 0.09
94 0.1
95 0.1
96 0.09
97 0.1
98 0.11
99 0.11
100 0.09
101 0.11
102 0.1
103 0.1
104 0.1
105 0.1
106 0.08
107 0.07
108 0.1
109 0.08
110 0.08
111 0.08
112 0.08
113 0.08
114 0.1
115 0.09
116 0.07
117 0.08
118 0.09
119 0.09
120 0.09
121 0.09