Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SIY1

Protein Details
Accession R7SIY1   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
122-143EAQAKAKKEKERGKEKEKEKATBasic
NLS Segment(s)
PositionSequence
99-141DKAAARAKVKAEAKKVTQAKVKEEAQAKAKKEKERGKEKEKEK
Subcellular Location(s) nucl 12.5cyto_nucl 12.5, cyto 9.5, mito 2, pero 2
Family & Domain DBs
KEGG fme:FOMMEDRAFT_162833  -  
Amino Acid Sequences MSLLLPSKSDIASKGMDMDDKLVECTLSSNAENKPEDKVVKEETDRLTTDPESEDKESSDNNAHNDNNSEGKEVLSVPVEGQSGNCKATVEELAKVKEDKAAARAKVKAEAKKVTQAKVKEEAQAKAKKEKERGKEKEKEKATALAQSATK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.18
4 0.17
5 0.18
6 0.16
7 0.15
8 0.16
9 0.13
10 0.12
11 0.11
12 0.12
13 0.11
14 0.12
15 0.12
16 0.15
17 0.17
18 0.23
19 0.24
20 0.23
21 0.26
22 0.27
23 0.28
24 0.26
25 0.29
26 0.27
27 0.3
28 0.31
29 0.32
30 0.31
31 0.33
32 0.31
33 0.28
34 0.27
35 0.23
36 0.22
37 0.19
38 0.17
39 0.18
40 0.18
41 0.18
42 0.15
43 0.16
44 0.15
45 0.16
46 0.18
47 0.16
48 0.16
49 0.19
50 0.19
51 0.18
52 0.2
53 0.19
54 0.18
55 0.17
56 0.16
57 0.13
58 0.12
59 0.12
60 0.11
61 0.1
62 0.08
63 0.07
64 0.06
65 0.07
66 0.07
67 0.06
68 0.07
69 0.09
70 0.09
71 0.1
72 0.1
73 0.09
74 0.09
75 0.1
76 0.13
77 0.12
78 0.14
79 0.16
80 0.16
81 0.18
82 0.18
83 0.17
84 0.16
85 0.16
86 0.14
87 0.18
88 0.23
89 0.24
90 0.28
91 0.31
92 0.3
93 0.36
94 0.41
95 0.41
96 0.41
97 0.44
98 0.43
99 0.49
100 0.51
101 0.49
102 0.5
103 0.48
104 0.47
105 0.48
106 0.48
107 0.45
108 0.46
109 0.44
110 0.47
111 0.5
112 0.49
113 0.5
114 0.55
115 0.56
116 0.62
117 0.66
118 0.68
119 0.72
120 0.78
121 0.79
122 0.82
123 0.82
124 0.82
125 0.78
126 0.73
127 0.65
128 0.62
129 0.55
130 0.52
131 0.47