Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SFG0

Protein Details
Accession R7SFG0    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-31LAPEKSKYKGKEKEKPVPRKKGKGLQSGKBasic
NLS Segment(s)
PositionSequence
7-26KSKYKGKEKEKPVPRKKGKG
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
KEGG fme:FOMMEDRAFT_163324  -  
Amino Acid Sequences MSLAPEKSKYKGKEKEKPVPRKKGKGLQSGKNTHPSGISDTETSQLDNKLKEEAEIIEQKDTKGKVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.82
4 0.87
5 0.87
6 0.88
7 0.87
8 0.87
9 0.85
10 0.83
11 0.81
12 0.8
13 0.78
14 0.75
15 0.75
16 0.71
17 0.65
18 0.64
19 0.56
20 0.46
21 0.4
22 0.32
23 0.27
24 0.23
25 0.22
26 0.15
27 0.15
28 0.17
29 0.16
30 0.16
31 0.14
32 0.15
33 0.17
34 0.17
35 0.17
36 0.18
37 0.18
38 0.18
39 0.18
40 0.16
41 0.19
42 0.23
43 0.24
44 0.26
45 0.27
46 0.27
47 0.32