Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2I4H5

Protein Details
Accession A0A0D2I4H5    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-24STTSPKRKVPYHHHHVMRHKLQAHydrophilic
230-256DSEASRQKCTPRQRKRWKKGVDQSEETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR037818  TAF8  
IPR019473  TFIID_su8_C  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
Pfam View protein in Pfam  
PF10406  TAF8_C  
CDD cd08049  TAF8  
Amino Acid Sequences MSTTSPKRKVPYHHHHVMRHKLQALPTREPTLLEQETVDKLLIDCIKAICEEEALKQDISSPVIESVALEALVGAVEEFVLKFLSKVRRSMLAARRTTPIASDFETAIDVFDVPRLDDQLRQYKTNHSINPPLLLTPPPEDEFHNTIDIPPSFLDPELDGHGQLQKFSFNTKGLPDLPSAHTFKDSPVYPYREVDTRRIRELATQEGKLGEQALRKLAGAVKLDAAHPLDSEASRQKCTPRQRKRWKKGVDQSEETIFEETLRDLLAKEPGGFELGPIVTCEKAYRMPDDVQVKRRPHMNGAASSGQEKPASSGPSGPDVMEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.84
4 0.84
5 0.8
6 0.77
7 0.71
8 0.65
9 0.63
10 0.64
11 0.61
12 0.58
13 0.55
14 0.52
15 0.49
16 0.47
17 0.43
18 0.42
19 0.36
20 0.29
21 0.26
22 0.24
23 0.25
24 0.24
25 0.21
26 0.13
27 0.12
28 0.17
29 0.17
30 0.15
31 0.15
32 0.14
33 0.15
34 0.15
35 0.16
36 0.11
37 0.12
38 0.12
39 0.14
40 0.17
41 0.19
42 0.18
43 0.17
44 0.2
45 0.2
46 0.2
47 0.18
48 0.15
49 0.13
50 0.13
51 0.13
52 0.1
53 0.09
54 0.08
55 0.07
56 0.06
57 0.05
58 0.05
59 0.05
60 0.04
61 0.03
62 0.02
63 0.02
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.05
70 0.11
71 0.2
72 0.23
73 0.26
74 0.28
75 0.32
76 0.35
77 0.45
78 0.47
79 0.47
80 0.48
81 0.47
82 0.48
83 0.44
84 0.41
85 0.33
86 0.27
87 0.2
88 0.19
89 0.19
90 0.16
91 0.15
92 0.16
93 0.14
94 0.11
95 0.09
96 0.07
97 0.05
98 0.07
99 0.06
100 0.06
101 0.07
102 0.09
103 0.09
104 0.12
105 0.17
106 0.25
107 0.27
108 0.29
109 0.3
110 0.34
111 0.41
112 0.44
113 0.43
114 0.38
115 0.42
116 0.4
117 0.41
118 0.35
119 0.28
120 0.23
121 0.2
122 0.18
123 0.14
124 0.15
125 0.14
126 0.15
127 0.16
128 0.19
129 0.2
130 0.2
131 0.19
132 0.16
133 0.15
134 0.17
135 0.16
136 0.13
137 0.11
138 0.1
139 0.09
140 0.09
141 0.1
142 0.07
143 0.08
144 0.09
145 0.09
146 0.09
147 0.09
148 0.12
149 0.11
150 0.11
151 0.1
152 0.09
153 0.09
154 0.1
155 0.12
156 0.1
157 0.12
158 0.12
159 0.15
160 0.15
161 0.16
162 0.15
163 0.16
164 0.18
165 0.21
166 0.21
167 0.19
168 0.19
169 0.18
170 0.18
171 0.19
172 0.17
173 0.18
174 0.23
175 0.27
176 0.27
177 0.28
178 0.29
179 0.3
180 0.32
181 0.36
182 0.39
183 0.37
184 0.39
185 0.39
186 0.37
187 0.36
188 0.37
189 0.37
190 0.32
191 0.29
192 0.27
193 0.26
194 0.26
195 0.22
196 0.2
197 0.13
198 0.11
199 0.12
200 0.13
201 0.13
202 0.13
203 0.14
204 0.15
205 0.17
206 0.17
207 0.16
208 0.16
209 0.16
210 0.17
211 0.17
212 0.16
213 0.12
214 0.11
215 0.11
216 0.1
217 0.1
218 0.13
219 0.19
220 0.2
221 0.22
222 0.24
223 0.29
224 0.36
225 0.47
226 0.55
227 0.58
228 0.67
229 0.77
230 0.87
231 0.91
232 0.94
233 0.92
234 0.91
235 0.9
236 0.9
237 0.87
238 0.8
239 0.73
240 0.66
241 0.59
242 0.48
243 0.4
244 0.29
245 0.2
246 0.16
247 0.13
248 0.1
249 0.09
250 0.08
251 0.07
252 0.09
253 0.13
254 0.13
255 0.13
256 0.14
257 0.14
258 0.16
259 0.15
260 0.13
261 0.13
262 0.12
263 0.12
264 0.12
265 0.13
266 0.11
267 0.12
268 0.13
269 0.12
270 0.17
271 0.19
272 0.22
273 0.25
274 0.27
275 0.34
276 0.42
277 0.47
278 0.5
279 0.56
280 0.56
281 0.56
282 0.6
283 0.57
284 0.54
285 0.56
286 0.54
287 0.5
288 0.52
289 0.52
290 0.47
291 0.45
292 0.4
293 0.34
294 0.28
295 0.24
296 0.21
297 0.23
298 0.25
299 0.24
300 0.27
301 0.26
302 0.31
303 0.31