Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2JDR2

Protein Details
Accession A0A0D2JDR2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-36LVHNKVHDKKQAKREKKRLAYEARYRBasic
NLS Segment(s)
PositionSequence
19-28KKQAKREKKR
Subcellular Location(s) nucl 13.5, mito_nucl 11.166, cyto_nucl 10.833, mito 7.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MASLIVAAGILVHNKVHDKKQAKREKKRLAYEARYRELEEEYASHQEKLPRQRSVREHQCEPRHGETLGPEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.21
4 0.29
5 0.36
6 0.44
7 0.54
8 0.64
9 0.7
10 0.78
11 0.84
12 0.86
13 0.88
14 0.87
15 0.84
16 0.83
17 0.81
18 0.79
19 0.74
20 0.67
21 0.59
22 0.52
23 0.44
24 0.36
25 0.28
26 0.19
27 0.14
28 0.12
29 0.16
30 0.16
31 0.15
32 0.16
33 0.2
34 0.25
35 0.34
36 0.39
37 0.42
38 0.44
39 0.52
40 0.58
41 0.64
42 0.69
43 0.66
44 0.68
45 0.7
46 0.74
47 0.73
48 0.72
49 0.67
50 0.59
51 0.52
52 0.46