Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2I4E1

Protein Details
Accession A0A0D2I4E1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
73-118DEPVKKTKVRERKMQREAKDKVREEKRNVSKKRARQYEEQKKLQKABasic
NLS Segment(s)
PositionSequence
76-117VKKTKVRERKMQREAKDKVREEKRNVSKKRARQYEEQKKLQK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.333, mito_nucl 11.666, cyto 5
Family & Domain DBs
Amino Acid Sequences MFEEIPSRSTDAVEVTAGSTLNQSQKPQAKTDSKLPSARQSRSIDIFKRFPLSPTKGLKDLAVQEITNRKEADEPVKKTKVRERKMQREAKDKVREEKRNVSKKRARQYEEQKKLQKAEEKRVRTLYMDGTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.11
4 0.1
5 0.1
6 0.09
7 0.1
8 0.16
9 0.17
10 0.18
11 0.25
12 0.33
13 0.35
14 0.38
15 0.44
16 0.45
17 0.47
18 0.55
19 0.55
20 0.53
21 0.56
22 0.54
23 0.56
24 0.57
25 0.55
26 0.53
27 0.49
28 0.48
29 0.48
30 0.51
31 0.47
32 0.44
33 0.45
34 0.38
35 0.38
36 0.34
37 0.31
38 0.33
39 0.34
40 0.36
41 0.38
42 0.39
43 0.37
44 0.38
45 0.36
46 0.3
47 0.27
48 0.22
49 0.18
50 0.15
51 0.15
52 0.2
53 0.21
54 0.21
55 0.19
56 0.17
57 0.17
58 0.19
59 0.26
60 0.29
61 0.33
62 0.38
63 0.44
64 0.45
65 0.47
66 0.55
67 0.56
68 0.53
69 0.59
70 0.62
71 0.66
72 0.75
73 0.8
74 0.78
75 0.77
76 0.77
77 0.77
78 0.76
79 0.69
80 0.69
81 0.71
82 0.72
83 0.69
84 0.74
85 0.75
86 0.75
87 0.77
88 0.78
89 0.76
90 0.77
91 0.81
92 0.81
93 0.76
94 0.76
95 0.82
96 0.83
97 0.84
98 0.84
99 0.82
100 0.77
101 0.76
102 0.73
103 0.7
104 0.67
105 0.68
106 0.69
107 0.66
108 0.67
109 0.68
110 0.63
111 0.57
112 0.53