Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2HDH7

Protein Details
Accession A0A0D2HDH7   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
447-488VADEQTKRGRRHWRRHPNMHHEGDRKRWRDKVTERERKRYEGBasic
NLS Segment(s)
PositionSequence
383-399PSKKVPPAIPRRRSKSV
453-485KRGRRHWRRHPNMHHEGDRKRWRDKVTERERKR
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR000261  EH_dom  
PROSITE View protein in PROSITE  
PS50031  EH  
CDD cd00052  EH  
Amino Acid Sequences MTEKQARRPPVAPKPSFIQQDAASPKTSPVPSPALRGATTAFGPGPAKLSNDGASHNPSAGALLAATAAASKIQQNQRQQQAQPARQNAPSPLEPPSTPRGRALTTENLPVAVSNHSSISPSKPGFQPHLPRSTSAVAAVAASARTSPARRPEIKRDQTGSYLKKPELSHEVRQRGMSTSSNSETVQSRQKSPDALAGAIASMTTAPVQAPAQNTSVDRQKTDLGPIPRLTLQSPHRSSASSPPPSGTAAAVTATKNAASVEARKRTPSTSGEGALNDISRDIGLSAQPIASSWPRIRFTPPQTDSESDSVRTTSETPRKPLPAPIPLRPSVAAIIAQEQANKTNSNSPILDARTKMTASSLADAMVASSLASQHTGSRVAPPSKKVPPAIPRRRSKSVRVVSGGRHHSHFPSPKTDSVSHPPKLTPLPVRPMRRTLRNQSPERDDVADEQTKRGRRHWRRHPNMHHEGDRKRWRDKVTERERKRYEGVWAANKGVLVDHDLDNPDLEPAKDGTLPSDLVVNVVVRDIWERSRLPKDVLEEVWDLVSQPGAKTLNREEFVVGLWLIDQRLKGRKLPIKVSPSVWQSVRHTQGVKIPSKPLQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.65
4 0.56
5 0.5
6 0.4
7 0.46
8 0.48
9 0.44
10 0.38
11 0.33
12 0.33
13 0.35
14 0.35
15 0.28
16 0.28
17 0.34
18 0.34
19 0.39
20 0.42
21 0.39
22 0.38
23 0.37
24 0.33
25 0.28
26 0.26
27 0.22
28 0.17
29 0.16
30 0.17
31 0.16
32 0.17
33 0.16
34 0.18
35 0.18
36 0.21
37 0.21
38 0.22
39 0.24
40 0.25
41 0.28
42 0.27
43 0.25
44 0.22
45 0.19
46 0.18
47 0.15
48 0.12
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.04
55 0.04
56 0.04
57 0.05
58 0.08
59 0.17
60 0.25
61 0.32
62 0.42
63 0.5
64 0.6
65 0.66
66 0.65
67 0.67
68 0.69
69 0.71
70 0.7
71 0.68
72 0.63
73 0.59
74 0.61
75 0.54
76 0.5
77 0.44
78 0.37
79 0.35
80 0.33
81 0.31
82 0.32
83 0.37
84 0.36
85 0.35
86 0.37
87 0.36
88 0.35
89 0.37
90 0.38
91 0.39
92 0.36
93 0.39
94 0.35
95 0.31
96 0.29
97 0.27
98 0.22
99 0.16
100 0.15
101 0.11
102 0.12
103 0.12
104 0.14
105 0.15
106 0.18
107 0.23
108 0.23
109 0.26
110 0.28
111 0.32
112 0.37
113 0.43
114 0.49
115 0.48
116 0.56
117 0.52
118 0.51
119 0.51
120 0.47
121 0.4
122 0.3
123 0.25
124 0.16
125 0.15
126 0.14
127 0.09
128 0.07
129 0.06
130 0.06
131 0.06
132 0.08
133 0.1
134 0.15
135 0.23
136 0.31
137 0.39
138 0.46
139 0.56
140 0.64
141 0.7
142 0.73
143 0.68
144 0.63
145 0.62
146 0.64
147 0.59
148 0.56
149 0.53
150 0.47
151 0.49
152 0.46
153 0.44
154 0.45
155 0.44
156 0.46
157 0.5
158 0.54
159 0.5
160 0.51
161 0.47
162 0.4
163 0.38
164 0.32
165 0.26
166 0.26
167 0.25
168 0.26
169 0.25
170 0.24
171 0.23
172 0.24
173 0.29
174 0.27
175 0.29
176 0.31
177 0.32
178 0.32
179 0.31
180 0.33
181 0.26
182 0.23
183 0.2
184 0.16
185 0.15
186 0.12
187 0.11
188 0.05
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.05
195 0.05
196 0.08
197 0.1
198 0.12
199 0.13
200 0.14
201 0.15
202 0.17
203 0.23
204 0.22
205 0.21
206 0.2
207 0.22
208 0.21
209 0.25
210 0.28
211 0.24
212 0.27
213 0.27
214 0.28
215 0.27
216 0.27
217 0.24
218 0.24
219 0.26
220 0.32
221 0.34
222 0.33
223 0.33
224 0.32
225 0.33
226 0.36
227 0.4
228 0.34
229 0.32
230 0.31
231 0.31
232 0.31
233 0.3
234 0.21
235 0.12
236 0.08
237 0.09
238 0.09
239 0.08
240 0.08
241 0.08
242 0.07
243 0.07
244 0.07
245 0.07
246 0.07
247 0.13
248 0.2
249 0.25
250 0.26
251 0.28
252 0.29
253 0.29
254 0.32
255 0.29
256 0.26
257 0.23
258 0.24
259 0.24
260 0.22
261 0.22
262 0.18
263 0.15
264 0.1
265 0.08
266 0.06
267 0.05
268 0.05
269 0.04
270 0.04
271 0.04
272 0.04
273 0.05
274 0.05
275 0.05
276 0.05
277 0.07
278 0.07
279 0.1
280 0.11
281 0.16
282 0.17
283 0.19
284 0.23
285 0.28
286 0.33
287 0.41
288 0.41
289 0.39
290 0.41
291 0.42
292 0.4
293 0.36
294 0.32
295 0.22
296 0.2
297 0.17
298 0.14
299 0.13
300 0.12
301 0.17
302 0.24
303 0.26
304 0.29
305 0.32
306 0.35
307 0.35
308 0.39
309 0.36
310 0.37
311 0.39
312 0.41
313 0.43
314 0.41
315 0.41
316 0.35
317 0.32
318 0.23
319 0.19
320 0.14
321 0.09
322 0.1
323 0.1
324 0.1
325 0.1
326 0.1
327 0.12
328 0.12
329 0.13
330 0.12
331 0.17
332 0.18
333 0.2
334 0.2
335 0.19
336 0.21
337 0.23
338 0.24
339 0.19
340 0.19
341 0.18
342 0.18
343 0.17
344 0.13
345 0.14
346 0.12
347 0.13
348 0.12
349 0.1
350 0.1
351 0.1
352 0.09
353 0.06
354 0.05
355 0.03
356 0.03
357 0.03
358 0.04
359 0.05
360 0.05
361 0.06
362 0.07
363 0.09
364 0.09
365 0.14
366 0.2
367 0.25
368 0.27
369 0.3
370 0.35
371 0.39
372 0.43
373 0.4
374 0.42
375 0.45
376 0.54
377 0.61
378 0.64
379 0.68
380 0.71
381 0.79
382 0.76
383 0.75
384 0.74
385 0.71
386 0.68
387 0.63
388 0.58
389 0.54
390 0.57
391 0.56
392 0.47
393 0.41
394 0.37
395 0.35
396 0.4
397 0.42
398 0.36
399 0.38
400 0.4
401 0.41
402 0.45
403 0.45
404 0.42
405 0.45
406 0.5
407 0.45
408 0.43
409 0.4
410 0.38
411 0.38
412 0.38
413 0.36
414 0.33
415 0.4
416 0.46
417 0.53
418 0.53
419 0.59
420 0.6
421 0.63
422 0.66
423 0.65
424 0.69
425 0.71
426 0.73
427 0.71
428 0.72
429 0.65
430 0.6
431 0.52
432 0.43
433 0.36
434 0.37
435 0.35
436 0.29
437 0.3
438 0.33
439 0.37
440 0.39
441 0.43
442 0.48
443 0.53
444 0.64
445 0.71
446 0.77
447 0.81
448 0.9
449 0.93
450 0.92
451 0.91
452 0.88
453 0.85
454 0.82
455 0.76
456 0.76
457 0.75
458 0.7
459 0.66
460 0.65
461 0.61
462 0.63
463 0.67
464 0.68
465 0.7
466 0.75
467 0.77
468 0.81
469 0.81
470 0.76
471 0.7
472 0.62
473 0.57
474 0.55
475 0.55
476 0.52
477 0.5
478 0.46
479 0.43
480 0.4
481 0.33
482 0.25
483 0.18
484 0.13
485 0.14
486 0.13
487 0.15
488 0.16
489 0.17
490 0.17
491 0.16
492 0.15
493 0.13
494 0.12
495 0.12
496 0.12
497 0.13
498 0.14
499 0.14
500 0.14
501 0.16
502 0.16
503 0.14
504 0.16
505 0.13
506 0.12
507 0.13
508 0.12
509 0.09
510 0.09
511 0.09
512 0.07
513 0.1
514 0.12
515 0.13
516 0.18
517 0.2
518 0.26
519 0.33
520 0.36
521 0.37
522 0.39
523 0.41
524 0.41
525 0.4
526 0.38
527 0.33
528 0.3
529 0.27
530 0.23
531 0.19
532 0.14
533 0.15
534 0.11
535 0.1
536 0.14
537 0.16
538 0.17
539 0.22
540 0.29
541 0.36
542 0.36
543 0.37
544 0.33
545 0.31
546 0.31
547 0.29
548 0.21
549 0.12
550 0.11
551 0.12
552 0.12
553 0.13
554 0.14
555 0.17
556 0.26
557 0.29
558 0.34
559 0.42
560 0.49
561 0.55
562 0.61
563 0.64
564 0.64
565 0.65
566 0.64
567 0.62
568 0.59
569 0.58
570 0.52
571 0.49
572 0.48
573 0.53
574 0.55
575 0.53
576 0.5
577 0.46
578 0.51
579 0.54
580 0.53
581 0.48
582 0.49