Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2H9A9

Protein Details
Accession A0A0D2H9A9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
206-238RGEGRRERMERIKRQERRQRNNERRSRKAGKFGBasic
NLS Segment(s)
PositionSequence
114-138RWKPLPKPKAPTKWELFARKKGIGK
205-238VRGEGRRERMERIKRQERRQRNNERRSRKAGKFG
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MATQTAADTPMEEVSAPTLSNRTASKPERLPTTVDKPTPYTYELGYLTAVDPNPLPSTTSLLASSLADRNQTLQTVARDGAQSLLNTLLTSCNITSTSDGLIMTLPPPTNPLPRWKPLPKPKAPTKWELFARKKGIGKYGGSVKGGAALQERRTNMVFDEESGEWVKKWGYKGRNKNRESDWLVELDDDKVSREKDGFGGEGRTVRGEGRRERMERIKRQERRQRNNERRSRKAGKFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.1
5 0.11
6 0.11
7 0.15
8 0.16
9 0.19
10 0.27
11 0.31
12 0.38
13 0.43
14 0.47
15 0.5
16 0.51
17 0.51
18 0.5
19 0.54
20 0.53
21 0.5
22 0.48
23 0.45
24 0.46
25 0.44
26 0.39
27 0.32
28 0.25
29 0.26
30 0.24
31 0.21
32 0.18
33 0.15
34 0.14
35 0.15
36 0.14
37 0.11
38 0.1
39 0.12
40 0.13
41 0.13
42 0.13
43 0.11
44 0.16
45 0.16
46 0.17
47 0.15
48 0.14
49 0.14
50 0.13
51 0.15
52 0.13
53 0.13
54 0.12
55 0.12
56 0.14
57 0.14
58 0.15
59 0.14
60 0.14
61 0.15
62 0.16
63 0.16
64 0.15
65 0.14
66 0.14
67 0.15
68 0.13
69 0.12
70 0.1
71 0.1
72 0.09
73 0.09
74 0.09
75 0.08
76 0.06
77 0.07
78 0.07
79 0.07
80 0.07
81 0.08
82 0.09
83 0.09
84 0.09
85 0.09
86 0.09
87 0.08
88 0.07
89 0.07
90 0.06
91 0.07
92 0.07
93 0.06
94 0.09
95 0.1
96 0.14
97 0.16
98 0.24
99 0.27
100 0.3
101 0.38
102 0.4
103 0.49
104 0.55
105 0.63
106 0.62
107 0.65
108 0.71
109 0.73
110 0.71
111 0.69
112 0.62
113 0.59
114 0.59
115 0.6
116 0.56
117 0.53
118 0.54
119 0.51
120 0.51
121 0.46
122 0.44
123 0.38
124 0.34
125 0.31
126 0.33
127 0.31
128 0.28
129 0.26
130 0.21
131 0.2
132 0.19
133 0.17
134 0.14
135 0.14
136 0.16
137 0.2
138 0.21
139 0.2
140 0.21
141 0.21
142 0.18
143 0.2
144 0.17
145 0.14
146 0.18
147 0.15
148 0.17
149 0.18
150 0.17
151 0.12
152 0.13
153 0.14
154 0.13
155 0.17
156 0.23
157 0.31
158 0.41
159 0.52
160 0.62
161 0.72
162 0.71
163 0.74
164 0.7
165 0.7
166 0.65
167 0.58
168 0.49
169 0.4
170 0.38
171 0.32
172 0.28
173 0.2
174 0.16
175 0.12
176 0.12
177 0.14
178 0.14
179 0.15
180 0.15
181 0.15
182 0.16
183 0.19
184 0.18
185 0.17
186 0.19
187 0.19
188 0.2
189 0.2
190 0.18
191 0.17
192 0.18
193 0.22
194 0.26
195 0.32
196 0.38
197 0.45
198 0.47
199 0.54
200 0.62
201 0.66
202 0.69
203 0.73
204 0.76
205 0.77
206 0.85
207 0.89
208 0.9
209 0.91
210 0.91
211 0.92
212 0.92
213 0.94
214 0.94
215 0.93
216 0.91
217 0.9
218 0.89