Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2JL29

Protein Details
Accession A0A0D2JL29   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-29ATSLRAKQKPLKDKYRSDPSSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR015946  KH_dom-like_a/b  
IPR003718  OsmC/Ohr_fam  
IPR036102  OsmC/Ohrsf  
Pfam View protein in Pfam  
PF02566  OsmC  
Amino Acid Sequences MSDAVMAAATSLRAKQKPLKDKYRSDPSSALVTLSSSGSLDPTSTSLTCSLSAGTAARKVAGLHKAAGGEGFDASGELCSGDMLLESLVACFGVTVRAVATSLGIPINNGTIIAEGDLDFRGTMGIKDPDGNAVSVGFTKIRLIVQLDVDEEYKSKVNKLIELSERYCVVLQTVKGGVDVETKLGHGDKIVNSAQGEGTVDTSPNKNVLEVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.33
3 0.42
4 0.52
5 0.61
6 0.68
7 0.71
8 0.78
9 0.82
10 0.85
11 0.79
12 0.74
13 0.67
14 0.59
15 0.55
16 0.47
17 0.37
18 0.26
19 0.23
20 0.19
21 0.16
22 0.13
23 0.08
24 0.07
25 0.08
26 0.08
27 0.07
28 0.07
29 0.08
30 0.1
31 0.1
32 0.12
33 0.12
34 0.13
35 0.13
36 0.13
37 0.12
38 0.09
39 0.1
40 0.1
41 0.1
42 0.11
43 0.11
44 0.11
45 0.11
46 0.11
47 0.16
48 0.19
49 0.19
50 0.17
51 0.18
52 0.18
53 0.18
54 0.17
55 0.12
56 0.08
57 0.07
58 0.06
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.02
79 0.03
80 0.03
81 0.03
82 0.03
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.04
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.04
96 0.04
97 0.03
98 0.03
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.05
105 0.05
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.07
112 0.08
113 0.08
114 0.09
115 0.09
116 0.11
117 0.12
118 0.12
119 0.09
120 0.08
121 0.08
122 0.08
123 0.08
124 0.06
125 0.06
126 0.06
127 0.07
128 0.07
129 0.08
130 0.1
131 0.11
132 0.12
133 0.13
134 0.13
135 0.13
136 0.14
137 0.12
138 0.11
139 0.11
140 0.13
141 0.13
142 0.13
143 0.17
144 0.18
145 0.21
146 0.24
147 0.29
148 0.32
149 0.37
150 0.37
151 0.35
152 0.34
153 0.31
154 0.29
155 0.22
156 0.18
157 0.16
158 0.15
159 0.16
160 0.17
161 0.15
162 0.15
163 0.16
164 0.15
165 0.14
166 0.14
167 0.12
168 0.11
169 0.11
170 0.13
171 0.13
172 0.12
173 0.1
174 0.14
175 0.14
176 0.19
177 0.2
178 0.21
179 0.2
180 0.21
181 0.2
182 0.17
183 0.17
184 0.12
185 0.14
186 0.12
187 0.13
188 0.14
189 0.16
190 0.17
191 0.19
192 0.19