Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2HB78

Protein Details
Accession A0A0D2HB78    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
96-126GHATKIEKASRQQRKQRKNRSKEFRGTAKAKHydrophilic
NLS Segment(s)
PositionSequence
102-134EKASRQQRKQRKNRSKEFRGTAKAKGASKDKKK
Subcellular Location(s) mito 18, nucl 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADSPVTIRTRKFITNRLLSRKQMVVDVLHPNRPNVSKDDLRAKLAEVYKSNKDQINVFGMRTQYGGGKSTGFALIYDSVEAMKKYEPYYRLVRVGHATKIEKASRQQRKQRKNRSKEFRGTAKAKGASKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.63
4 0.68
5 0.7
6 0.66
7 0.65
8 0.6
9 0.52
10 0.44
11 0.38
12 0.31
13 0.28
14 0.35
15 0.33
16 0.35
17 0.35
18 0.33
19 0.35
20 0.35
21 0.33
22 0.28
23 0.32
24 0.29
25 0.33
26 0.42
27 0.4
28 0.39
29 0.37
30 0.34
31 0.33
32 0.32
33 0.32
34 0.25
35 0.28
36 0.3
37 0.32
38 0.35
39 0.31
40 0.29
41 0.26
42 0.25
43 0.27
44 0.23
45 0.21
46 0.2
47 0.18
48 0.18
49 0.17
50 0.15
51 0.1
52 0.1
53 0.11
54 0.09
55 0.09
56 0.09
57 0.1
58 0.1
59 0.08
60 0.07
61 0.07
62 0.08
63 0.08
64 0.07
65 0.06
66 0.06
67 0.07
68 0.07
69 0.07
70 0.07
71 0.09
72 0.1
73 0.15
74 0.17
75 0.2
76 0.26
77 0.28
78 0.32
79 0.31
80 0.32
81 0.33
82 0.34
83 0.33
84 0.32
85 0.31
86 0.29
87 0.35
88 0.35
89 0.33
90 0.38
91 0.46
92 0.51
93 0.59
94 0.66
95 0.71
96 0.8
97 0.87
98 0.91
99 0.92
100 0.92
101 0.93
102 0.93
103 0.93
104 0.92
105 0.89
106 0.87
107 0.85
108 0.79
109 0.74
110 0.71
111 0.67
112 0.61
113 0.6
114 0.6