Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2J3Q3

Protein Details
Accession A0A0D2J3Q3    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
65-85VPDENIQPKLKRRKKRTGHETBasic
NLS Segment(s)
PositionSequence
73-81KLKRRKKRT
Subcellular Location(s) nucl 20, cyto_nucl 14.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MAINLPPQDFPMPNLNLPLVDSVNDLKNPILETPAPRELLEKKYLSPGATLVENGVQIDGYAGDVPDENIQPKLKRRKKRTGHET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.22
4 0.23
5 0.22
6 0.14
7 0.11
8 0.12
9 0.12
10 0.14
11 0.14
12 0.14
13 0.12
14 0.13
15 0.13
16 0.12
17 0.12
18 0.11
19 0.13
20 0.18
21 0.21
22 0.21
23 0.2
24 0.22
25 0.23
26 0.25
27 0.28
28 0.23
29 0.2
30 0.23
31 0.24
32 0.22
33 0.19
34 0.16
35 0.13
36 0.13
37 0.12
38 0.09
39 0.08
40 0.08
41 0.07
42 0.06
43 0.05
44 0.04
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.05
52 0.06
53 0.08
54 0.09
55 0.1
56 0.13
57 0.18
58 0.22
59 0.31
60 0.42
61 0.49
62 0.59
63 0.67
64 0.75
65 0.82